KEGG   Arabidopsis thaliana (thale cress): AT5G60360Help
Entry
AT5G60360         CDS       T00041                                 

Gene name
ALP
Definition
(RefSeq) thiol protease aleurain
  KO
K01366  
cathepsin H [EC:3.4.22.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.16  cathepsin H
     AT5G60360 (ALP)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C1: papain family
   AT5G60360 (ALP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 358 aa AA seqDB search
MSAKTILSSVVLVVLVAASAAANIGFDESNPIRMVSDGLREVEESVSQILGQSRHVLSFA
RFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFADLTWQEFQRTKL
GAAQNCSATLKGSHKVTEAALPETKDWREDGIVSPVKDQGGCGSCWTFSTTGALEAAYHQ
AFGKGISLSEQQLVDCAGAFNNYGCNGGLPSQAFEYIKSNGGLDTEKAYPYTGKDETCKF
SAENVGVQVLNSVNITLGAEDELKHAVGLVRPVSIAFEVIHSFRLYKSGVYTDSHCGSTP
MDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDKGYFKMEMGKNMCGIATCASYPVVA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaaaacaatcctatcatcagtagttttggtggttctcgtcgccgcatcagca
gcggctaatatcggattcgatgagtcaaacccgatccgaatggtctccgatggtctccgg
gaggtagaagaatctgtttcccagatcttaggtcaatctcgtcacgttctctctttcgct
cgcttcactcaccgatatggtaaaaagtatcagaacgtggaggagatgaagcttcgattc
tcgattttcaaggagaatcttgatttgatcagatccaccaacaagaaaggcttatcttac
aaactcggtgttaatcaatttgctgatttgacatggcaagagtttcaaaggaccaagctt
ggtgctgctcagaactgctctgccactttaaagggcagccacaaggtcacagaagcagct
cttcctgaaacaaaagactggagagaagatggtatcgttagtccggtcaaagatcaggga
ggttgtggatcttgctggacattcagcacaactggagctcttgaggcagcttaccatcag
gcatttggaaaaggaatttctctctctgagcaacagcttgtggattgtgctggagctttc
aataactatggttgcaatggtggccttccttctcaagcctttgaatacatcaaatccaac
ggtggcctcgacacagagaaagcttatccttataccggtaaagatgaaacctgcaaattt
tcagctgaaaacgttggtgtacaagtcctcaactcagtcaacattactctgggtgctgaa
gatgaactgaagcatgcggttggattggtacggccagtaagcatagcatttgaggttata
cactcgttccggctttacaagagtggagtttacactgatagtcactgtggaagtactcca
atggatgtgaaccacgcggttttggccgttggttatggagttgaagacggtgtaccatat
tggcttattaagaactcatggggagcggattggggcgacaaaggttacttcaagatggag
atggggaagaacatgtgtggtattgctacatgtgcatcataccccgttgtggcttga

DBGET integrated database retrieval system