KEGG   Arabidopsis thaliana (thale cress): AT5G60440Help
Entry
AT5G60440         CDS       T00041                                 

Gene name
AGL62
Definition
(RefSeq) agamous-like MADS-box protein AGL62
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 299 aa AA seqDB search
MVKKSKGRQKIEMVKMKNESNLQVTFSKRRSGLFKKASELCTLCGAEVAIVVFSPGRKVF
SFGHPNVDSVIDRFINNNPLPPHQHNNMQLRETRRNSIVQDLNNHLTQVLSQLETEKKKY
DELKKIREKTKALGNWWEDPVEELALSQLEGFKGNLENLKKVVTVEASRFFQANVPNFYV
GSSSNNAAFGIDDGSHINPDMDLFSQRRMMDINAFNYNQNQIHPNHALPPFGNNAYGINE
GFVPEYNVNFRPEYNPNQNQIQNQNQVQIQIQNQSFKRENISEYEHHHGYPPQSRSDYY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaaaagcaaaggtcgtcaaaaaatagagatggtcaaaatgaaaaatgaaagt
aaccttcaagttactttttcaaaaagaagatctggacttttcaaaaaggctagtgagctt
tgcacactttgtggtgcagaagtggccatagttgtgttctcacctggtcgaaaagtcttt
tcttttggtcatccaaatgttgattctgtaattgatcgattcataaacaataaccctcta
cctcctcaccaacacaacaacatgcaacttagagaaactcgtcgaaattcgattgttcag
gatctgaataatcatcttactcaggtgttgagtcaattagaaacagagaaaaagaagtac
gacgagttaaagaaaataagagaaaagacaaaagcccttgggaattggtgggaagatccc
gttgaggaacttgcgttatctcaactcgaggggttcaaaggtaatcttgaaaatttgaag
aaagtagttacagtcgaagcttccagattttttcaggcaaatgttccaaacttctatgtg
ggaagttctagtaataatgctgcttttgggattgatgatggtagtcatatcaaccctgat
atggatctctttagccaaagaagaatgatggacataaatgccttcaactacaaccagaac
caaattcaccctaatcatgcattaccaccctttggaaacaatgcttatggtattaatgaa
gggtttgttccagaatacaatgtgaacttcagaccagagtataacccaaaccaaaaccaa
atccaaaaccaaaatcaagttcaaatccaaatccaaaaccagagttttaagagagaaaac
atctctgaatatgaacatcatcatggttatcctccccagtctagatctgattactattaa

DBGET integrated database retrieval system