KEGG   Arabidopsis thaliana (thale cress): AT5G60640Help
Entry
AT5G60640         CDS       T00041                                 

Gene name
PDIL1-4
Definition
(RefSeq) protein disulfide isomerase-like 1-4
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT5G60640 (PDIL1-4)
Enzymes [BR:ath01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AT5G60640 (PDIL1-4)
Chaperones and folding catalysts [BR:ath03110]
 Protein folding catalysts
  Protein disulfide isomerase
   AT5G60640 (PDIL1-4)
Membrane trafficking [BR:ath04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    AT5G60640 (PDIL1-4)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AT5G60640 (PDIL1-4)
  Exosomal proteins of colorectal cancer cells
   AT5G60640 (PDIL1-4)
  Exosomal proteins of bladder cancer cells
   AT5G60640 (PDIL1-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 597 aa AA seqDB search
MAFRVLLLFSLTALLIFSAVSPSFAASSSDDVDDEDLSFLEDLKEDDVPGADSLSSSTGF
DEFEGGEEEDPDMYNDDDDEEGDFSDLGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENN
QYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTLL
FFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYNLTTLDDAEKVLTSGNKVVLGYLNSLVG
VEHDQLNAASKAEDDVNFYQTVNPDVAKMFHLDPESKRPALVLVKKEEEKISHFDGEFVK
SALVSFVSANKLALVSVFTRETAPEIFESAIKKQLLLFVTKNESEKVLTEFQEAAKSFKG
KLIFVSVDLDNEDYGKPVAEYFGVSGNGPKLIGYTGNEDPKKYFFDGEIQSDKIKIFGED
FLNDKLKPFYKSDPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPM
YNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILFFPAGNKTSEPITVDTDRTVVA
FYKFLRKHATIPFKLEKPASTESPKTAESTPKVETTETKESPDSTTKSSQSDSKDEL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccgcgttttgctcctcttctcactcaccgcacttctcatcttctccgccgtt
tctccttctttcgccgcttcttcctccgacgacgttgacgatgaggatctcagcttcctc
gaagatctcaaagaagacgacgttcccggcgctgactcactctcttcctcaactggattt
gacgaattcgaaggaggagaagaagaagatcccgatatgtacaacgacgatgacgatgaa
gaaggagatttttccgatctaggtaatccggattccgatccgttaccgacgccggagatt
gatgagaaagacgttgtggttatcaaggagcgtaacttcactgatgtgattgagaataat
caatacgttttggttgagttttatgctccgtggtgtggtcattgtcagtctcttgctcct
gagtatgctgctgctgccacggagcttaaggaagatggtgttgttttggctaagattgat
gcgacggaggagaatgagttagctcaggagtatcgtgttcagggctttccgacgcttctt
ttcttcgttgatggtgagcacaagccttacactggaggaaggactaaagaaacaattgtg
acatgggtgaagaagaagattggtcctggtgtgtataatctaactacattagatgatgct
gagaaagtgttgacttctgggaacaaagttgttttgggatacttgaactccttggtgggt
gttgagcacgatcagcttaatgctgcttccaaagctgaagacgatgtgaacttttatcaa
acagtgaatcctgatgttgcaaagatgtttcaccttgatccggagtctaaaaggcctgct
cttgtcctagttaagaaggaagaggagaaaattagccattttgatggagaatttgttaag
tctgctctagttagttttgtgtctgccaacaagcttgctttggtctctgttttcaccaga
gagactgctccggaaatttttgagagtgcaatcaagaaacagttgttgttgtttgtaacc
aaaaatgaatctgaaaaggttcttacggaatttcaagaagcagcgaaatcattcaaagga
aagctcatctttgtatctgtggatctggataatgaggattatgggaagccagtcgctgaa
tactttggtgtgtctggaaatggtcctaaacttattggctacacagggaatgaagaccct
aaaaaatactttttcgatggcgagatccagtcagataaaattaagatatttggggaggat
ttcctgaacgacaagttaaagcctttctataagtcagaccccattcctgaaaagaacgat
gaagatgtgaaaatagtggttggagataactttgatgaaattgttctggacgattctaaa
gatgtgcttctcgaggtctacgcaccatggtgtggccattgccaagcccttgagccaatg
tataacaaacttgccaagcatttacgaagtattgattctctcgtcataaccaagatggat
ggaacaaccaatgaacatcccaaggcaaaggctgaggggttccctaccattctcttcttc
cctgcgggcaacaagacttcagagccgattactgtagatacagaccgcactgtggttgca
ttttacaagttcttaaggaaacacgcaacgatcccattcaaactggagaaacctgcatca
accgaatcacctaaaactgcagagtccacaccaaaagtagaaactaccgagaccaaagaa
tcacccgatagcacgacaaagagtagccaaagtgactcgaaggacgaattgtga

DBGET integrated database retrieval system