KEGG   Arabidopsis thaliana (thale cress): AT5G61410Help
Entry
AT5G61410         CDS       T00041                                 

Gene name
RPE
Definition
(RefSeq) D-ribulose-5-phosphate-3-epimerase
  KO
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT5G61410 (RPE)
   01230 Biosynthesis of amino acids
    AT5G61410 (RPE)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT5G61410 (RPE)
   00040 Pentose and glucuronate interconversions
    AT5G61410 (RPE)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT5G61410 (RPE)
Enzymes [BR:ath01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     AT5G61410 (RPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 281 aa AA seqDB search
MSTSAASLCCSSTQVNGFGLRPERSLLYQPTSFSFSRRRTHGIVKASSRVDRFSKSDIIV
SPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDV
HLMIVEPEQRVPDFIKAGADIVSVHCEQQSTIHLHRTVNQIKSLGAKAGVVLNPGTPLSA
IEYVLDMVDLVLIMSVNPGFGGQSFIESQVKKISDLRKMCAEKGVNPWIEVDGGVTPANA
YKVIEAGANALVAGSAVFGAKDYAEAIKGIKASKRPAAVAV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctccgccgcttccttgtgttgttcatcaacccaggtcaatgggtttggtctt
aggcctgaaaggtcgcttctttaccaacccacttccttttctttctccagaaggagaact
catggaattgtcaaggcctcatctcgggttgataggttttcgaaaagtgatatcattgtt
tctccctctattctctcggctaatttcgccaaattaggcgagcaggtaaaagcagtggag
ttggcaggttgtgattggattcatgttgatgtcatggacggtcgttttgttcccaacatt
actatcggacctctcgtggttgatgctttgcgccctgtgacagatcttcctttggatgtt
catctgatgatagtggaacccgagcagagagtaccggatttcatcaaagcaggtgcagat
attgtcagtgtacattgtgaacagcaatccaccatccatttgcatcgtaccgtcaatcaa
ataaaaagcttaggggctaaagctggagttgttctaaaccctggaaccccattgagtgca
atagaatatgtcttggatatggtggatctggtcttgatcatgtcggtcaaccctggtttt
ggtggacagagctttattgaaagccaagtaaagaaaatctcggacttgaggaaaatgtgt
gcagagaagggagtaaacccatggattgaagttgatggtggtgtcactccagcgaatgcg
tacaaggttattgaggctggagcaaatgctctagtggctggatcagctgtatttggagct
aaggactacgcagaagctataaaaggaattaaggccagcaaacgaccagcagctgtagct
gtgtaa

DBGET integrated database retrieval system