KEGG   Arabidopsis thaliana (thale cress): AT5G61410Help
Entry
AT5G61410         CDS       T00041                                 

Gene name
RPE
Definition
(RefSeq) D-ribulose-5-phosphate-3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00030  Pentose phosphate pathway
ath00040  Pentose and glucuronate interconversions
ath00710  Carbon fixation in photosynthetic organisms
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ath_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT5G61410 (RPE)
   00040 Pentose and glucuronate interconversions
    AT5G61410 (RPE)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT5G61410 (RPE)
Enzymes [BR:ath01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     AT5G61410 (RPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribul_P_3_epim Sp38 IMPDH NanE TMP-TENI ThiG
Motif
Other DBs
NCBI-GeneID: 836262
NCBI-ProteinID: NP_200949
MIPS: AT5G61410.1
TAIR: AT5G61410
Araport: AT5G61410
UniProt: Q9SAU2 A0A178UPG9
Position
5
AA seq 281 aa AA seqDB search
MSTSAASLCCSSTQVNGFGLRPERSLLYQPTSFSFSRRRTHGIVKASSRVDRFSKSDIIV
SPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDV
HLMIVEPEQRVPDFIKAGADIVSVHCEQQSTIHLHRTVNQIKSLGAKAGVVLNPGTPLSA
IEYVLDMVDLVLIMSVNPGFGGQSFIESQVKKISDLRKMCAEKGVNPWIEVDGGVTPANA
YKVIEAGANALVAGSAVFGAKDYAEAIKGIKASKRPAAVAV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctccgccgcttccttgtgttgttcatcaacccaggtcaatgggtttggtctt
aggcctgaaaggtcgcttctttaccaacccacttccttttctttctccagaaggagaact
catggaattgtcaaggcctcatctcgggttgataggttttcgaaaagtgatatcattgtt
tctccctctattctctcggctaatttcgccaaattaggcgagcaggtaaaagcagtggag
ttggcaggttgtgattggattcatgttgatgtcatggacggtcgttttgttcccaacatt
actatcggacctctcgtggttgatgctttgcgccctgtgacagatcttcctttggatgtt
catctgatgatagtggaacccgagcagagagtaccggatttcatcaaagcaggtgcagat
attgtcagtgtacattgtgaacagcaatccaccatccatttgcatcgtaccgtcaatcaa
ataaaaagcttaggggctaaagctggagttgttctaaaccctggaaccccattgagtgca
atagaatatgtcttggatatggtggatctggtcttgatcatgtcggtcaaccctggtttt
ggtggacagagctttattgaaagccaagtaaagaaaatctcggacttgaggaaaatgtgt
gcagagaagggagtaaacccatggattgaagttgatggtggtgtcactccagcgaatgcg
tacaaggttattgaggctggagcaaatgctctagtggctggatcagctgtatttggagct
aaggactacgcagaagctataaaaggaattaaggccagcaaacgaccagcagctgtagct
gtgtaa

DBGET integrated database retrieval system