KEGG   Arabidopsis thaliana (thale cress): AT5G61580Help
Entry
AT5G61580         CDS       T00041                                 

Gene name
PFK4
Definition
(RefSeq) phosphofructokinase 4
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00030  Pentose phosphate pathway
ath00051  Fructose and mannose metabolism
ath00052  Galactose metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
ath03018  RNA degradation
Module
ath_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT5G61580 (PFK4)
   00030 Pentose phosphate pathway
    AT5G61580 (PFK4)
   00051 Fructose and mannose metabolism
    AT5G61580 (PFK4)
   00052 Galactose metabolism
    AT5G61580 (PFK4)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AT5G61580 (PFK4)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AT5G61580 (PFK4)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT5G61580 (PFK4)
Messenger RNA biogenesis [BR:ath03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AT5G61580 (PFK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 836279
NCBI-ProteinID: NP_200966
MIPS: AT5G61580.1
TAIR: AT5G61580
Araport: AT5G61580
UniProt: Q9FKG3 A0A178UCI3
Position
5
AA seq 530 aa AA seqDB search
MEASISFLGSTKPNISLFNPSSNVLPRRDFPLPALKLKKVSVLPRILHQKRLIRAQCSDG
FKPEEDDGFVLEDVPHLTKFLPDLPSYPNPLKESQAYAIVKRTFVSSEDVVAQNIVVQKG
SKRGVHFRRAGPRERVYFRSDEVKACIVTCGGLCPGINTVIREIVCGLNNMYGVNNILGI
QGGYRGFYSKNTMNLTPKVVNDIHKRGGTFLQTSRGGHDTAKIVDNIQDRGINQVYIIGG
GGTQKGAEKIYEEVERRGLQVAVSGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVE
VESVENGVGIVKLMGRYSGFIAMIATLANRDVDCCLIPESPFFLEGKGGLFEFIEERLKE
NRHMVIVIAEGAGQDYVAQSMRASETKDASGNRLLLDVGLWLTQQIKDHFTNVRKMMINM
KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYSGFTVGPVNSRHAYIPISQVTEV
TNTVKLTDRMWARLLASTNQPSFLTGEGALQNVIDMETQEKIDNMKISSI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaagcttcgatttcgtttctggggtcaacaaaacccaatatttccttgtttaaccct
tcttcaaacgtccttcctcgtagagatttccctcttcctgctttgaaattgaagaaagtt
tcagtgctgcctcgaatcttgcaccagaaacgactcatcagagctcagtgctctgatgga
ttcaaaccagaggaagacgatgggtttgtcctagaagacgttcctcacttgaccaaattt
ctccctgatttaccgtcatatccaaatccattgaaagaaagccaagcatatgccattgtt
aagcgaacttttgtcagttccgaagatgtggttgcgcaaaatattgtagtccagaaggga
agtaagcgaggagtacactttaggcgagcagggcctcgagaaagagtgtacttcagatca
gatgaagtaaaagcttgcatagtgacttgtgggggcttgtgccctggaatcaatactgtt
atacgggaaattgtatgtggattgaacaatatgtatggtgttaataacattctcggcatt
cagggaggatatagaggcttttactccaaaaacactatgaacctgacacctaaagtagtt
aacgatattcataaacgcggtggcacttttcttcaaacctcaagaggaggacatgataca
gcgaagattgttgataatattcaagatagaggaataaatcaggtatatattattggaggt
ggtgggacgcaaaagggtgcagagaagatatacgaggaagttgagaggcgtggtcttcaa
gtggcggtttctggcattcctaagacaattgataatgatattgctgtgattgacaaatca
tttggctttgatacggcggttgaggaagcacaacgagctattaatgctgcacatgtagag
gtcgagagcgtggaaaatggagttggtatcgttaaactcatgggcagatacagtggtttt
attgccatgattgcaactttagcgaatcgtgatgtggattgttgcttgattccagagtct
ccattttttcttgaaggaaagggtgggctctttgagtttattgaagaacgactcaaagag
aataggcacatggttattgtgatagctgaaggagctggacaggattatgttgctcaaagc
atgcgtgcatctgaaactaaagacgcctcaggaaatagactcttgcttgatgttggtcta
tggttgactcaacagataaaggatcactttacaaatgttcggaaaatgatgataaatatg
aagtacatagacccaacgtatatgataagagcaataccgagtaacgcatcagacaatgtc
tattgcactcttcttgcccaaagtgcagttcatggagcaatggctgggtactcaggtttc
actgtaggaccagttaacagtagacatgcttacatcccaatttctcaggtgacggaagtg
acaaatacggtgaagttaactgataggatgtgggctagactccttgcatcgacaaatcaa
ccgagtttcttgactggtgaaggagcattgcagaatgtgatcgacatggaaactcaagaa
aagatcgataacatgaagatctcttctatctaa

DBGET integrated database retrieval system