KEGG   Arabidopsis thaliana (thale cress): AT5G61850Help
Entry
AT5G61850         CDS       T00041                                 

Gene name
LFY
Definition
(RefSeq) protein LEAFY
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
5
AA seq 420 aa AA seqDB search
MDPEGFTSGLFRWNPTRALVQAPPPVPPPLQQQPVTPQTAAFGMRLGGLEGLFGPYGIRF
YTAAKIAELGFTASTLVGMKDEELEEMMNSLSHIFRWELLVGERYGIKAAVRAERRRLQE
EEEEESSRRRHLLLSAAGDSGTHHALDALSQEGLSEEPVQQQDQTDAAGNNGGGGSGYWD
AGQGKMKKQQQQRRRKKPMLTSVETDEDVNEGEDDDGMDNGNGGSGLGTERQREHPFIVT
EPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASY
INKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDID
AVFNAHPRLSIWYVPTKLRQLCHLERNNAVAAAAALVGGISCTGSSTSGRGGCGGDDLRF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgaaggtttcacgagtggcttattccggtggaacccaacgagagcattggtt
caagcaccacctccggttccacctccgctgcagcaacagccggtgacaccgcagacggct
gcttttgggatgcgacttggtggtttagagggactattcggtccgtacggtatacgtttc
tacacggcggcgaagatagcggagttaggttttacggcgagcacgcttgtgggtatgaag
gacgaggagcttgaagagatgatgaatagtctctctcatatctttcgttgggagcttctt
gttggtgaacggtacggtatcaaagctgccgttagagctgaacggagacgattgcaagaa
gaggaggaagaggaatcttctagacgccgtcatttgctactctccgccgctggtgattcc
ggtactcatcacgctcttgatgctctctcccaagaagggttatctgaggaaccggtgcag
caacaagaccagactgatgcggcggggaataacggcggaggaggaagtggttactgggac
gcaggtcaaggaaagatgaagaagcaacagcagcagagacggagaaagaaaccaatgctg
acgtcagtggaaaccgacgaagacgtcaacgaaggtgaggatgacgacgggatggataac
ggcaacggaggtagtggtttggggacagagagacagagggagcatccgtttatcgtaacg
gagcctggggaagtggcacgtggcaaaaagaacggcttagattatctgttccacttgtac
gaacaatgccgtgagttccttcttcaggtccagacaattgctaaagaccgtggcgaaaaa
tgccccaccaaggtgacgaaccaagtattcaggtacgcgaagaaatcaggagcgagttac
ataaacaagcctaaaatgcgacactacgttcactgttacgctctccactgcctagacgaa
gaagcttcaaatgctctcagaagagcgtttaaagaacgcggtgagaacgttggctcatgg
cgtcaggcttgttacaagccacttgtgaacatcgcttgtcgtcatggctgggatatagac
gccgtctttaacgctcatcctcgtctctctatttggtatgttccaacaaagctgcgtcag
ctttgccatttggagcggaacaatgcggttgctgcggctgcggctttagttggcggtatt
agctgtaccggatcgtcgacgtctggacgtggtggatgcggcggcgacgacttgcgtttc
tag

DBGET integrated database retrieval system