KEGG   Arabidopsis thaliana (thale cress): AT5G62790Help
Entry
AT5G62790         CDS       T00041                                 

Gene name
DXR
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00900  Terpenoid backbone biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT5G62790 (DXR)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AT5G62790 (DXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 836400
NCBI-ProteinID: NP_201085
MIPS: AT5G62790.1
TAIR: AT5G62790
Araport: AT5G62790
UniProt: Q9XFS9
Position
5
AA seq 477 aa AA seqDB search
MMTLNSLSPAESKAISFLDTSRFNPIPKLSGGFSLRRRNQGRGFGKGVKCSVKVQQQQQP
PPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTL
LADQVRRFKPALVAVRNESLINELKEALADLDYKLEIIPGEQGVIEVARHPEAVTVVTGI
VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQCIQ
GLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLE
VIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVP
CSEVTWPRLDLCKLGSLTFKKPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFID
EKISYLDIFKVVELTCDKHRNELVTSPSLEEIVHYDLWAREYAANVQLSSGARPVHA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgacattaaactcactatctccagctgaatccaaagctatttctttcttggatacc
tccaggttcaatccaatccctaaactctcaggtgggtttagtttgaggaggaggaatcaa
gggagaggttttggaaaaggtgttaagtgttcagtgaaagtgcagcagcaacaacaacct
cctccagcatggcctgggagagctgtccctgaggcgcctcgtcaatcttgggatggacca
aaacccatctctatcgttggatctactggttctattggcactcagacattggatattgtg
gctgagaatcctgacaaattcagagttgtggctctagctgctggttcgaatgttactcta
cttgctgatcaggtaaggagatttaagcctgcattggttgctgttagaaacgagtcactg
attaatgagcttaaagaggctttagctgatttggactataaactcgagattattccagga
gagcaaggagtgattgaggttgcccgacatcctgaagctgtaaccgttgttaccggaata
gtaggttgtgcgggactaaagcctacggttgctgcaattgaagcaggaaaggacattgct
cttgcaaacaaagagacattaatcgcaggtggtcctttcgtgcttccgcttgccaacaaa
cataatgtaaagattcttccggcagattcagaacattctgccatatttcagtgtattcaa
ggtttgcctgaaggcgctctgcgcaagataatcttgactgcatctggtggagcttttagg
gattggcctgtcgaaaagctaaaggaagttaaagtagcggatgcgttgaagcatccaaac
tggaacatgggaaagaaaatcactgtggactctgctacgcttttcaacaagggtcttgag
gtcattgaagcgcattatttgtttggagctgagtatgacgatatagagattgtcattcat
ccgcaaagtatcatacattccatgattgaaacacaggattcatctgtgcttgctcaattg
ggttggcctgatatgcgtttaccgattctctacaccatgtcatggcccgatagagttcct
tgttctgaagtaacttggccaagacttgacctttgcaaactcggttcattgactttcaag
aaaccagacaatgtgaaatacccatccatggatcttgcttatgctgctggacgagctgga
ggcacaatgactggagttctcagcgccgccaatgagaaagctgttgaaatgttcattgat
gaaaagataagctatttggatatcttcaaggttgtggaattaacatgcgataaacatcga
aacgagttggtaacatcaccgtctcttgaagagattgttcactatgacttgtgggcacgt
gaatatgccgcgaatgtgcagctttcttctggtgctaggccagttcatgcatga

DBGET integrated database retrieval system