KEGG   Arabidopsis thaliana (thale cress): AT5G62790Help
Entry
AT5G62790         CDS       T00041                                 

Gene name
DXR
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT5G62790 (DXR)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AT5G62790 (DXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 497 aa AA seqDB search
MTLNSLSPAESKAISFLDTSRFNPIPKLSGGFSLRRRNQGRGFGKGVKCSVKVQQQQQPP
PAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLL
ADQFSGSIISKIVLTRYVSDQTREIRRFKPALVAVRNESLINELKEALADLDYKLEIIPG
EQGVIEVARHPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANK
HNVKILPADSEHSAIFQCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPN
WNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQL
GWPDMRLPILYTMSWPDRVPCSEVTWPRLDLCKLGSLTFKKPDNVKYPSMDLAYAAGRAG
GTMTGVLSAANEKAVEMFIDEKISYLDIFKVVELTCDKHRNELVTSPSLEEIVHYDLWAR
EYAANVQLSSGARPVHA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacattaaactcactatctccagctgaatccaaagctatttctttcttggatacctcc
aggttcaatccaatccctaaactctcaggtgggtttagtttgaggaggaggaatcaaggg
agaggttttggaaaaggtgttaagtgttcagtgaaagtgcagcagcaacaacaacctcct
ccagcatggcctgggagagctgtccctgaggcgcctcgtcaatcttgggatggaccaaaa
cccatctctatcgttggatctactggttctattggcactcagacattggatattgtggct
gagaatcctgacaaattcagagttgtggctctagctgctggttcgaatgttactctactt
gctgatcagttcagtggtagtatcataagcaagatagtattaactcgttatgtatcagat
caaaccagagaaatcaggagatttaagcctgcattggttgctgttagaaacgagtcactg
attaatgagcttaaagaggctttagctgatttggactataaactcgagattattccagga
gagcaaggagtgattgaggttgcccgacatcctgaagctgtaaccgttgttaccggaata
gtaggttgtgcgggactaaagcctacggttgctgcaattgaagcaggaaaggacattgct
cttgcaaacaaagagacattaatcgcaggtggtcctttcgtgcttccgcttgccaacaaa
cataatgtaaagattcttccggcagattcagaacattctgccatatttcagtgtattcaa
ggtttgcctgaaggcgctctgcgcaagataatcttgactgcatctggtggagcttttagg
gattggcctgtcgaaaagctaaaggaagttaaagtagcggatgcgttgaagcatccaaac
tggaacatgggaaagaaaatcactgtggactctgctacgcttttcaacaagggtcttgag
gtcattgaagcgcattatttgtttggagctgagtatgacgatatagagattgtcattcat
ccgcaaagtatcatacattccatgattgaaacacaggattcatctgtgcttgctcaattg
ggttggcctgatatgcgtttaccgattctctacaccatgtcatggcccgatagagttcct
tgttctgaagtaacttggccaagacttgacctttgcaaactcggttcattgactttcaag
aaaccagacaatgtgaaatacccatccatggatcttgcttatgctgctggacgagctgga
ggcacaatgactggagttctcagcgccgccaatgagaaagctgttgaaatgttcattgat
gaaaagataagctatttggatatcttcaaggttgtggaattaacatgcgataaacatcga
aacgagttggtaacatcaccgtctcttgaagagattgttcactatgacttgtgggcacgt
gaatatgccgcgaatgtgcagctttcttctggtgctaggccagttcatgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system