KEGG   Arabidopsis thaliana (thale cress): AT5G63110Help
Entry
AT5G63110         CDS       T00041                                 

Gene name
HDA6
Definition
RPD3-like histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AT5G63110 (HDA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 471 aa AA seqDB search
MEADESGISLPSGPDGRKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHSLIIHYHLHRR
LEISRPSLADASDIGRFHSPEYVDFLASVSPESMGDPSAARNLRRFNVGEDCPVFDGLFD
FCRASAGGSIGAAVKLNRQDADIAINWGGGLHHAKKSEASGFCYVNDIVLGILELLKMFK
RVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIRDVGAEKGKYYALNVPL
NDGMDDESFRSLFRPLIQKVMEVYQPEAVVLQCGADSLSGDRLGCFNLSVKGHADCLRFL
RSYNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYFEYFGPDYTLHVDPS
PMENLNTPKDMERIRNTLLEQLSGLIHAPSVQFQHTPPVNRVLDEPEDDMETRPKPRIWS
GTATYESDSDDDDKPLHGYSCRGGATTDRDSTGEDEMDDDNPEPDVNPPSS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagacgaaagcggcatctctctgccgtcgggacccgacggacgtaagcggcga
gtcagttacttctacgagccgacgatcggagactactactacggtcaaggccacccgatg
aagcctcaccggatccgtatggctcatagcctaatcattcactatcacctccaccgtcgc
ttagaaatcagtcgccctagcctcgctgacgcctccgatatcggccgattccattcgccg
gagtatgttgacttcctcgcttccgtttcgccggaatctatgggcgatccttccgctgca
cgaaacctaaggcgattcaatgtcggtgaggattgtcctgtcttcgacggactttttgat
ttttgccgtgcttccgccggaggttctattggtgctgccgtcaaattaaacagacaggac
gctgatatcgctatcaattggggcggtgggcttcaccatgctaagaaaagcgaggcttct
gggttttgctatgtaaacgacatcgtgctagggattctggagttgctcaagatgtttaag
cgggttctctacatagatattgatgtccaccatggagatggagtggaagaagcgttttac
accactgatagagttatgactgtttctttccacaaatttggggactttttcccaggaact
ggtcacataagagatgttggcgctgaaaaagggaaatactatgctctaaatgttccacta
aacgatggtatggacgatgaaagtttccgcagcttgtttagacctcttatccagaaggtt
atggaagtgtatcagccagaggcagttgttcttcagtgtggtgctgactccttaagtggt
gatcggttgggttgcttcaacttatcagtcaagggtcacgctgattgccttcggttctta
agatcttacaacgttcctctcatggtgttgggtggtggagggtatactattcgaaatgtt
gcccgttgctggtgttatgagactgcagttgctgttggagtagagccggacaacaaactc
ccttacaatgagtattttgagtatttcggcccagattatacgcttcatgtcgacccaagt
cctatggagaatttaaacacgcccaaagatatggagaggataaggaacacgttgctggaa
caactttcgggactaatacacgcacctagcgtccagtttcagcacacaccaccagtcaat
cgagttttggacgagccggaagatgacatggagacaagaccaaaacctcgcatctggagt
ggaactgcgacttatgaatcagacagtgacgatgatgataaacctcttcatggttactca
tgtcgtggtggcgcaactacggacagggactctaccggtgaagatgaaatggatgacgat
aacccagagccagacgtgaatcctccatcgtcttaa

DBGET integrated database retrieval system