KEGG   Arabidopsis thaliana (thale cress): AT5G63790Help
Entry
AT5G63790         CDS       T00041                                 

Gene name
NAC102
Definition
(RefSeq) NAC domain-containing protein 102
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 312 aa AA seqDB search
MDFALFSSISIFEINHKDPPIRRFIKTQNRILSTRKQQGTFPKMKAELNLPAGFRFHPTD
EELVKFYLCRRCASEPINVPVIAEIDLYKFNPWELPEMALYGEKEWYFFSHRDRKYPNGS
RPNRAAGTGYWKATGADKPIGKPKTLGIKKALVFYAGKAPKGIKTNWIMHEYRLANVDRS
ASTNKKNNLRLDDWVLCRIYNKKGTMEKYLPAAAEKPTEKMSTSDSRCSSHVISPDVTCS
DNWEVESEPKWINLEDALEAFNDDTSMFSSIGLLQNDAFVPQFQYQSSDFVDSFQDPFEQ
KPFLNWNFAPQG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggactttgctctcttctcctcgatttcaatctttgagataaaccacaaagatcctccg
attcgaaggtttataaaaactcaaaatcgaatcttatccacaagaaaacaacaaggtact
tttccaaaaatgaaggcggagttgaatttgccggcgggattccgatttcatccgacggac
gaagagcttgtcaagttctatctttgccggagatgtgcgtcagaaccgattaacgttccg
gttatcgcagagattgacttgtacaaattcaatccatgggagcttccagaaatggcgttg
tacggtgagaaagaatggtacttcttctcgcatagagaccggaaatacccaaacgggtcg
agaccaaaccgggcagctggaaccggttattggaaagcgactggagctgataaaccgatc
ggaaaaccgaagacgttagggattaagaaagcactcgtcttctacgcaggaaaagctccg
aaagggattaaaacgaattggattatgcacgagtatcgtctcgctaatgtcgatcgatct
gcttctaccaacaagaagaacaacttaagacttgatgattgggttttgtgtcggatatac
aataagaaaggaacaatggagaagtatttaccggcggcggctgagaaaccgacggaaaag
atgagtacgtcggactcaagatgctcaagtcacgtgatttcaccggacgtcacgtgttct
gataactgggaggttgagagtgagcccaaatggattaatctggaagacgcgttagaggca
tttaatgatgacacgtccatgtttagttccattggtttgttgcaaaatgacgcctttgtt
cctcagtttcagtaccagtcctccgatttcgtcgattcgtttcaggacccgttcgagcag
aaaccgttcttgaattggaattttgctcctcaagggtaa

DBGET integrated database retrieval system