KEGG   Arabidopsis thaliana (thale cress): AT5G63890Help
Entry
AT5G63890         CDS       T00041                                 

Gene name
HDH
Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT5G63890 (HDH)
  Amino acid metabolism
   00340 Histidine metabolism
    AT5G63890 (HDH)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AT5G63890 (HDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 466 aa AA seqDB search
MSLNLSRLSLLSSPRISISTHAPRKGYVCCSMKSYRLSELSSSQVDSLKSRPRIDFSSIF
ATVNPIIDAVRSNGDNAVKEYTERFDKVQLNKVVEDMSELSVPELDSNVKEAFDVAYDNI
YAFHLAQKSTEKSVENMKGVRCKRVSRSIGSVGLYVPGGTAVLPSTALMLAIPAQIAGCK
TVVLATPPSKDGSICKEVLYCAKRAGVTHILKAGGAQAIAAMAWGTDSCPKVEKIFGPGN
QYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADEHASPVYIAADLLSQAEHGPDSQVVLV
VVGDSVDLNAIEEEIAKQCKSLPRGEFASKALSHSFTVFARDMIEAISFSNLYAPEHLII
NVKDAEKWEGLIENAGSVFIGPWTPESVGDYASGTNHVLPTYGYARMYSGVSLDSFLKFM
TVQSLTEEGLRNLGPYVATMAEIEGLDAHKRAVTLRLKDIEAKQLA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcaatctgtctcgtctttcgcttctctcgtccccacgtatctcgatttcaact
cacgctcctcggaaaggatacgtttgttgctctatgaagtcttatagattatctgaactt
agttcttcccaagttgatagtttgaagtcacgccctcgcattgacttctcttctattttc
gccactgtgaacccgattatcgatgctgttcgtagcaatggggataatgctgtcaaagaa
tacactgaaagatttgacaaagtccagctgaataaagttgtggaagatatgtctgagctt
tctgttcctgagctcgattccaatgtcaaagaagcgtttgatgttgcgtatgacaacata
tatgcgtttcacttagcccaaaagtcaactgagaaaagcgttgagaatatgaaaggtgtc
agatgtaaaagggtgtcaagatctattggctctgtaggtctttatgtgcctggtggaaca
gctgttttgccatcaacggctttgatgcttgctattcctgctcaaattgctggatgtaaa
acagttgttcttgcaactccaccaagtaaggatggaagcatttgtaaggaggttctgtat
tgcgccaagagggctggtgttactcacatactcaaagctggtggagcgcaggctatagct
gccatggcctgggggacagattcttgtccaaaggttgagaagatttttggtcctgggaac
cagtatgtcacagctgctaagatgattcttcaaaacagcgaggcaatggtctcaatcgat
atgcctgctggtccttcagaagtcctagttattgctgacgaacatgctagtccagtttac
attgcagcagacttactttctcaggcggagcatggtccagatagtcaagttgttcttgta
gttgtgggcgatagtgtagatctcaacgccatcgaagaagaaattgccaagcagtgcaaa
agccttcctagaggagagtttgcttcaaaagcactaagtcacagtttcacagtgtttgct
cgagatatgattgaggcaatatctttctcaaatctatatgcacccgaacatttgatcatc
aatgtcaaagacgctgagaaatgggagggactgattgagaacgcaggctcggttttcata
ggaccatggactccagagagtgttggggattatgcgagcgggacaaaccacgttcttcca
acatatggatatgcaagaatgtacagtggcgtctctctcgactctttcctaaagttcatg
actgtacaatctttgacagaggaaggtctgagaaacctcggcccttatgtagcaactatg
gctgaaatcgaaggtttagatgcacacaagagagccgttactctcagactcaaggatatc
gaagccaaacagcttgcataa

DBGET integrated database retrieval system