KEGG   Arabidopsis thaliana (thale cress): AT5G63990Help
Entry
AT5G63990         CDS       T00041                                 

Definition
putative SAL3 phosphatase
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT5G63990
  Energy metabolism
   00920 Sulfur metabolism
    AT5G63990
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AT5G63990
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AT5G63990
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     AT5G63990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 357 aa AA seqDB search
MSYDEMLSAAKKAVSLAARLSNEVRKSLLVTDVWNKSDDSPVTVADYGSQAVVSLVLERE
LQNEPVSLVAEEDSGELRKIAAETVLARITELVKDTLASDESYAIASPLTSDDVLNAIDR
GKSEGGPKGRHWILDPIGGTRGFIRGEQYAIGLALLVEGKVVLGVMACPKLPLASTAGNA
LKSLPEKVGCLFYGSVGNGTYVQSLSVDSLPAKVEVSSIDDPAKASFFESYHTPVPIHNT
IATKLGIKESPIKINSQTKYAALSRGDGEVYLRFTRKARPESIWNHAAGSIIVSEAGGKV
TDAAGNPLDFSKGKYLDYKRGIVVTTQKLLPRLLTAVRESIKEEEEEEEKAASLKLH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgatgagatgctttctgctgcgaagaaagctgtttctctcgctgctcgtctc
agcaacgaagtgaggaaatctctgttggtaactgacgtttggaacaaatcagatgatagt
cctgttactgttgctgattatggttcgcaggcggtggttagccttgtactggaaagggaa
ctccagaatgaacctgtgtctttagtggctgaagaggattctggtgagttaaggaagatt
gctgctgagaccgttttggctcgtattacagagcttgtcaaagatactcttgcaagtgat
gaatcatatgctattgcttctcctttgacttcggatgatgtgctcaacgctatagatcgt
ggtaaatcagaaggaggtcctaagggtcgccactggatcttggatcctattggtggcact
agaggatttataagaggagaacaatatgcaataggattagcattgttggtggaaggcaaa
gtagtactaggtgtaatggcttgtcctaagcttccattggcatcaactgctggtaatgca
ctcaagtctttacctgaaaaagttggttgccttttctatggttcggttggcaatgggact
tatgtccagtctctcagtgtcgactctcttcctgcgaaggtggaggttagcagcatagat
gatcctgcgaaagcgagtttcttcgagtcataccacacacctgtccccatccataacacc
attgctacgaaattggggataaaagaatctccaatcaagatcaacagccagactaagtat
gcagctttatctagaggagatggagaggtttacttgaggtttactcgcaaagcaagaccc
gaatcaatatggaatcacgctgctggctcaatcattgtttcagaagcaggagggaaagtg
actgatgcagcagggaatccattggacttttcgaaagggaagtatcttgattacaagaga
ggaatcgtcgttacgacgcagaaactgttgccaaggcttttaacagcagtaagagaatca
attaaagaagaagaagaggaagaagaaaaagctgcttctctaaaacttcactaa

DBGET integrated database retrieval system