KEGG   Arabidopsis thaliana (thale cress): AT5G64330Help
Entry
AT5G64330         CDS       T00041                                 

Gene name
NPH3
Definition
(RefSeq) Phototropic-responsive NPH3 family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
5
AA seq 746 aa AA seqDB search
MMWESESDGGVGVGGGGGREYGDGVLSSNKHGGVKTDGFELRGQSWFVATDIPSDLLVKI
GDMNFHLHKYPLLSRSGKMNRLIYESRDPDPTILILDDLPGGPEAFELASKFCYGVPVDL
TATNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSILVLKSCEKLSPWAE
NLQIVRRCSESIAWKACSNPKGIRWAYTGKAPSPSTTNFAGSSPRWNESKDSSFYCSPSR
NTNSQPVPPDWWFEDVSILRIDHFVRVITAIKVKGMRFELLGAVIMHYAGKWLPGLIKEG
GVAIAPAMSSAIGGGLGLGGDEMSISCGSNSSGGSSGPDWKGGLHMVLSAGKTNGHQDSV
ACLAGLGISPKDQRMIVESLISIIPPQKDSVTCSFLLRLLRAANMLKVAPALITELEKRV
GMQFEQATLQDLLIPGYNNKGETMYDVDLVQRLLEHFLVQEQTEGSSPSRMSPSPSQSMY
ADIPRGNNNNGGGGGGNNQNAKMRVARLVDSYLTEVARDRNLPLTKFQVLAEALPESART
CDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSMDACMHAAQNERLPLRVVVQVLF
SEQVKISNALANTSLKESTTLGEAMGTYQPMIPNRKTLIEATPQSFQEGWAAAKKDINTL
KFELETVKTKYVELQNEMEVMQRQFEKTGKVKNTPSSSAWTSGWKKLSKLTKMSGQESHD
ISSGGEQAGVDHPPPRKPRRWRNSIS
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgggaatctgagagcgacggtggggttggagttggaggtggaggaggaagagag
tatggtgatggagttttgagttctaacaagcatggcggcgtcaagactgatgggtttgag
cttagaggccaatcttggtttgttgctacggatatccccagcgatcttctggttaagatc
ggcgacatgaactttcaccttcacaagtatccgttgctgtcacgtagcgggaagatgaac
agattgatctatgagtcacgagatcctgacccgacgatccttattcttgatgatctacct
ggaggaccagaagcgtttgagcttgcatccaaattctgctatggagttcccgtggatctc
acggcaactaacatatcaggattacgttgtgcagctgagtatcttgagatgacagaggat
cttgaggaagggaatctaatcttcaagacagaagcttttctcagctatgtggttctgtct
tcatggagagactccatcttggtcctgaagagctgtgaaaagctctcaccttgggctgag
aatcttcagattgtgagaaggtgtagtgaatctatcgcttggaaagcttgtagtaatcca
aaaggtattagatgggcttacacagggaaagctccatctccatcaacaacaaatttcgcg
ggttctagtccgagatggaacgaatcaaaagattcaagtttctattgtagtccgagtagg
aacactaatagccagcctgttcctccagattggtggttcgaagatgtctccatcttaaga
atcgatcatttcgttcgtgtaatcactgcaatcaaggtgaaaggtatgagatttgaacta
ctcggagctgtaataatgcattacgccggaaaatggcttccgggtttgatcaaagaagga
ggagttgcaatagctccagcaatgtcctccgccattggaggaggattaggtttaggagga
gacgaaatgagtataagctgcggaagcaacagcagcggaggaagctccggaccagattgg
aaaggcggtcttcatatggttctctccgccggaaaaacaaacggacatcaagattccgtc
gcttgtctcgccggactaggaatcagtccaaaagaccaacgaatgatcgtcgaatcttta
atcagcataatccctccacagaaagattccgtcacttgtagcttcctcctccgtcttctt
agagcagcaaacatgctcaaagtagctccggcgttgatcacggagctcgagaaacgcgta
gggatgcaattcgaacaagcgacgcttcaagatcttttgattcctggttataacaataaa
ggagagacaatgtacgatgttgatcttgttcagagattgttggaacattttcttgtgcaa
gaacagacggaaggatcgagtccgagtcgaatgtcgccgtcgccgtcgcagtctatgtac
gccgatatcccgagagggaataacaacaatggtggtggtggtggtggtaataatcagaat
gcgaaaatgagagtggcgaggcttgtggatagttatctcaccgaagttgctagagatcgg
aatttgccgttgacaaagtttcaggttttggctgaggcgttaccggaatctgctaggact
tgtgacgatggactatacagagccattgattcatatctcaaggcgcatccgacattatcg
gagcatgagaggaaacggctatgccgagtgatggattgtcaaaaactatcaatggacgca
tgtatgcacgcggctcagaacgagaggttgccattgagagtggtggttcaagttctcttc
tcggagcaagtcaagatcagcaatgctttagccaacacatcactcaaggagtcaaccact
ttaggagaagccatgggtacgtatcagcctatgatcccaaatcgcaagacattgatcgaa
gcaacaccacaatcgtttcaggaaggatgggctgcagccaagaaggatattaacacgttg
aagttcgagttagagacggtgaagaccaagtacgtcgagcttcagaacgagatggaagtg
atgcaacgacagtttgagaagacggggaaagtgaagaacacgccatcttcttcggcttgg
accagcggttggaagaagctaagtaaactgactaagatgagtggacaggagagccatgac
atatcctctggaggagaacaagctggtgttgatcatccaccccccaggaaaccaagacga
tggaggaactcaatttcatga

DBGET integrated database retrieval system