KEGG   Arabidopsis thaliana (thale cress): AT5G64620Help
Entry
AT5G64620         CDS       T00041                                 

Gene name
C/VIF2
Definition
(RefSeq) cell wall / vacuolar inhibitor of fructosidase 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 180 aa AA seqDB search
MASSLIFLLLVTLTFSASTLISAKSNTTTIIESTCKTTNYYKFCVSALKSDPRSPTADTK
GLASIMVGVGMTNATSTANYIAGNLSATVKDTVLKKVLQDCSEKYALAADSLRLTIQDLD
DEAYDYASMHVLAAQDYPNVCRNIFRRVKGLAYPVEIRRREASLRRICGVVSGILDRLVE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctctcatcttcctcctcctcgttaccctaaccttttcagcatcaacccta
atctcagccaaatccaacacaacaacaataatcgaatcaacttgcaaaaccacaaactac
tacaaattctgcgtctcagctctcaaatccgacccaagaagtcccacagccgacacaaaa
ggtctcgcctccattatggtcggcgttggtatgacaaacgccacctccaccgcaaattac
atcgctggaaacctatccgccaccgtaaaagacaccgttctcaaaaaggtcttacaagat
tgctccgagaagtatgctctcgccgctgattctctccggctgacgattcaagatcttgat
gatgaagcttatgactatgcctccatgcatgtgttggcggcgcaggattatcctaatgtt
tgccggaatatttttaggcgggttaaagggttggcttatccggtggagattcgccggcgt
gaagctagtctgagacgtatttgtggtgttgtctccgggattcttgatcgccttgttgaa
tga

DBGET integrated database retrieval system