KEGG   Arabidopsis thaliana (thale cress): AT5G64860Help
Entry
AT5G64860         CDS       T00041                                 

Gene name
DPE1
Definition
(RefSeq) disproportionating enzyme
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00500  Starch and sucrose metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT5G64860 (DPE1)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AT5G64860 (DPE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-GeneID: 836609
NCBI-ProteinID: NP_201291
MIPS: AT5G64860.1
TAIR: AT5G64860
Araport: AT5G64860
UniProt: Q9LV91
Structure
PDB: 

Jmol
Position
5
AA seq 576 aa AA seqDB search
MSILLRPSSSPSLCSSLKLFRLSSPDSLIDAAVLRNRTKPSQSFRMEVVSSNSTCLSSIS
VGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSV
WQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTAN
KLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWP
EPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGY
HSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRI
RRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAE
DLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGW
WDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPA
TEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctacttaggccgtcgtcctctccttcactctgttcttctctcaagcttttc
cgattatcctctccggattctttaatcgacgcagctgtcctcaggaacaggacaaagccg
tcgcagtcgtttcgaatggaggtcgtttcgagtaattccacgtgtctttctagtattagc
gtcggtgaagattttccatcagaatatgagcagtggctaccggttccggatccagagagc
aggagaagagctggcgttttgctacacccgacgtcgtttcgtggtcctcatggcattggt
gatctcggagaagaagccttccggttcatcgattggcttcattctactggttgctccgtt
tggcaggttcttcctcttgttcctccagacgaaggaggatctccttatgcaggacaggat
gcaaattgtgggaacacattgttgatttctctagatgagcttgtgaaagacggcttgtta
atcaaggatgagctcccacaaccaattgatgctgactctgtgaactatcagactgccaac
aagttaaagagtcccttgattacgaaggcagcaaagaggcttattgatggcaatggtgaa
ctgaagagcaaactgctagatttccgtaacgacccctctatatcatgttggcttgaagat
gctgcttattttgcagctattgacaatactttaaatgcatacagttggtttgagtggcct
gaaccacttaaaaaccgtcatctttctgccttggaagctatatatgaaagccaaaaggag
tttatagacttgttcattgctaagcaatttttgttccaaaggcagtggcagaaagttcgt
gagtatgcacggcggcaaggagttgatataatgggagatatgcccatttatgtaggatat
cacagtgcagacgtttgggcaaataagaaacatttcttactgaacaagaaaggctttcct
cttcttgttagcggtgttcctcctgacttgttcagtgaaactggtcaactgtggggcagc
cctctttatgactggaaagcaatggagagtgaccaatattcttggtgggttaatcgaata
agacgcgcacaggacttgtatgacgaatgcaggattgatcacttcagaggatttgcaggg
ttttgggcggtcccttctgaagcgaaagttgccatggttggacgatggaaggtaggacct
ggaaagtcattatttgatgccatttccaaaggcgttgggaagatcaaaatcatagctgaa
gatttgggagttattactaaagatgtagttgagctgaggaaatctatcggagcacctgga
atggccgtcctccaatttgcttttggaggaggcgccgataacccacatttacctcacaat
catgaagtaaaccaagttgtatactctggaactcatgacaacgacactattcgaggctgg
tgggacactctggaccaagaagaaaagtctaaggcaatgaaatacctgtcgatagctgga
gaagacgatatatcatggtcagtcatccaagctgcattctcttcaaccgctcaaaccgca
atcataccgatgcaagacattctaggacttggaagttctgccaggatgaacactccagcc
actgaggtggggaattggggttggaggattccaagttcaacgagctttgataatcttgaa
actgaatctgacagactcagagatcttttgtcattgtacggacggctttga

DBGET integrated database retrieval system