KEGG   Arabidopsis thaliana (thale cress): AT5G64860Help
Entry
AT5G64860         CDS       T00041                                 

Gene name
DPE1
Definition
4-alpha-glucanotransferase DPE1
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT5G64860 (DPE1)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AT5G64860 (DPE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 576 aa AA seqDB search
MSILLRPSSSPSLCSSLKLFRLSSPDSLIDAAVLRNRTKPSQSFRMEVVSSNSTCLSSIS
VGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSV
WQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTAN
KLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWP
EPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGY
HSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRI
RRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAE
DLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGW
WDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPA
TEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctacttaggccgtcgtcctctccttcactctgttcttctctcaagcttttc
cgattatcctctccggattctttaatcgacgcagctgtcctcaggaacaggacaaagccg
tcgcagtcgtttcgaatggaggtcgtttcgagtaattccacgtgtctttctagtattagc
gtcggtgaagattttccatcagaatatgagcagtggctaccggttccggatccagagagc
aggagaagagctggcgttttgctacacccgacgtcgtttcgtggtcctcatggcattggt
gatctcggagaagaagccttccggttcatcgattggcttcattctactggttgctccgtt
tggcaggttcttcctcttgttcctccagacgaaggaggatctccttatgcaggacaggat
gcaaattgtgggaacacattgttgatttctctagatgagcttgtgaaagacggcttgtta
atcaaggatgagctcccacaaccaattgatgctgactctgtgaactatcagactgccaac
aagttaaagagtcccttgattacgaaggcagcaaagaggcttattgatggcaatggtgaa
ctgaagagcaaactgctagatttccgtaacgacccctctatatcatgttggcttgaagat
gctgcttattttgcagctattgacaatactttaaatgcatacagttggtttgagtggcct
gaaccacttaaaaaccgtcatctttctgccttggaagctatatatgaaagccaaaaggag
tttatagacttgttcattgctaagcaatttttgttccaaaggcagtggcagaaagttcgt
gagtatgcacggcggcaaggagttgatataatgggagatatgcccatttatgtaggatat
cacagtgcagacgtttgggcaaataagaaacatttcttactgaacaagaaaggctttcct
cttcttgttagcggtgttcctcctgacttgttcagtgaaactggtcaactgtggggcagc
cctctttatgactggaaagcaatggagagtgaccaatattcttggtgggttaatcgaata
agacgcgcacaggacttgtatgacgaatgcaggattgatcacttcagaggatttgcaggg
ttttgggcggtcccttctgaagcgaaagttgccatggttggacgatggaaggtaggacct
ggaaagtcattatttgatgccatttccaaaggcgttgggaagatcaaaatcatagctgaa
gatttgggagttattactaaagatgtagttgagctgaggaaatctatcggagcacctgga
atggccgtcctccaatttgcttttggaggaggcgccgataacccacatttacctcacaat
catgaagtaaaccaagttgtatactctggaactcatgacaacgacactattcgaggctgg
tgggacactctggaccaagaagaaaagtctaaggcaatgaaatacctgtcgatagctgga
gaagacgatatatcatggtcagtcatccaagctgcattctcttcaaccgctcaaaccgca
atcataccgatgcaagacattctaggacttggaagttctgccaggatgaacactccagcc
actgaggtggggaattggggttggaggattccaagttcaacgagctttgataatcttgaa
actgaatctgacagactcagagatcttttgtcattgtacggacggctttga

DBGET integrated database retrieval system