KEGG   Arabidopsis thaliana (thale cress): AT5G65940Help
Entry
AT5G65940         CDS       T00041                                 

Gene name
CHY1
Definition
beta-hydroxyisobutyryl-CoA hydrolase 1
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ath01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ath00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ath00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ath00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 328 aa AA seqDB search
MAVEMASQSQVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAFEEDPSVKLVILK
GHGRAFCAGGDVAAVVRDINQGNWRLGANYFSSEYMLNYVMATYSKAQVSILNGIVMGGG
AGVSVHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEM
LACGLATHFVPSTRLTALEADLCRINSNDPTFASTILDAYTQHPRLKQQSAYRRLDVIDR
CFSRRTVEEIISALEREATQEADGWISATIQALKKGSPASLKISLRSIREGRLQGVGQCL
IREYRMVCHVMKGEISKDFVEVLQAFSI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgagatggcctctcagtctcaggttttggtggaagagaaatcgagtgttaga
atcttgacactaaacagaccaaagcagctgaatgctctgtccttccacatgatctctcga
ttgctgcaactgttccttgcatttgaggaggaccctagtgtgaaacttgtcatcctaaag
ggtcatgggagagccttttgtgctggtggcgatgttgcagctgttgttcgtgacatcaat
caaggtaactggagactcggtgccaattacttctcatctgaatacatgctcaactatgtt
atggccacatatagcaaagctcaggtttcaatcttgaatggtatcgtcatgggaggcgga
gctggtgtatccgtccatggtcgatttcgtattgcaactgagaacacggtttttgccatg
cctgagacagctctggggctctttccagatgtaggcgcctcctacttcttgtcaaggctc
cctggtttttttggggagtatgttggcctcacaggagctagattagatggtgctgaaatg
cttgcttgtggccttgcaactcattttgtgccttcaacgaggttgactgcattagaagca
gatctttgcagaattaattcaaatgatccaacttttgcctcaacaattctcgatgcatac
acccagcatccgcgcctgaaacagcagagtgcttaccgcaggttagatgttattgatagg
tgtttctcaaggagaacagtcgaagaaattatatctgcacttgagagagaggccactcaa
gaagcagatggttggatctcagctaccattcaagcattgaagaagggttcaccagcaagc
cttaaaatctctcttagatcgataagggaagggcgattgcagggggtggggcagtgtctt
atccgcgagtatagaatggtgtgtcatgtgatgaagggagaaatcagcaaagattttgtg
gaggttttgcaagctttttccatctga

DBGET integrated database retrieval system