KEGG   Arabidopsis thaliana (thale cress): AT5G65940Help
Entry
AT5G65940         CDS       T00041                                 

Gene name
CHY1
Definition
beta-hydroxyisobutyryl-CoA hydrolase 1
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT5G65940 (CHY1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AT5G65940 (CHY1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT5G65940 (CHY1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G65940 (CHY1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     AT5G65940 (CHY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 328 aa AA seqDB search
MAVEMASQSQVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAFEEDPSVKLVILK
GHGRAFCAGGDVAAVVRDINQGNWRLGANYFSSEYMLNYVMATYSKAQVSILNGIVMGGG
AGVSVHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEM
LACGLATHFVPSTRLTALEADLCRINSNDPTFASTILDAYTQHPRLKQQSAYRRLDVIDR
CFSRRTVEEIISALEREATQEADGWISATIQALKKGSPASLKISLRSIREGRLQGVGQCL
IREYRMVCHVMKGEISKDFVEVLQAFSI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgagatggcctctcagtctcaggttttggtggaagagaaatcgagtgttaga
atcttgacactaaacagaccaaagcagctgaatgctctgtccttccacatgatctctcga
ttgctgcaactgttccttgcatttgaggaggaccctagtgtgaaacttgtcatcctaaag
ggtcatgggagagccttttgtgctggtggcgatgttgcagctgttgttcgtgacatcaat
caaggtaactggagactcggtgccaattacttctcatctgaatacatgctcaactatgtt
atggccacatatagcaaagctcaggtttcaatcttgaatggtatcgtcatgggaggcgga
gctggtgtatccgtccatggtcgatttcgtattgcaactgagaacacggtttttgccatg
cctgagacagctctggggctctttccagatgtaggcgcctcctacttcttgtcaaggctc
cctggtttttttggggagtatgttggcctcacaggagctagattagatggtgctgaaatg
cttgcttgtggccttgcaactcattttgtgccttcaacgaggttgactgcattagaagca
gatctttgcagaattaattcaaatgatccaacttttgcctcaacaattctcgatgcatac
acccagcatccgcgcctgaaacagcagagtgcttaccgcaggttagatgttattgatagg
tgtttctcaaggagaacagtcgaagaaattatatctgcacttgagagagaggccactcaa
gaagcagatggttggatctcagctaccattcaagcattgaagaagggttcaccagcaagc
cttaaaatctctcttagatcgataagggaagggcgattgcagggggtggggcagtgtctt
atccgcgagtatagaatggtgtgtcatgtgatgaagggagaaatcagcaaagattttgtg
gaggttttgcaagctttttccatctga

DBGET integrated database retrieval system