KEGG   Arabidopsis thaliana (thale cress): AT5G66220Help
Entry
AT5G66220         CDS       T00041                                 

Definition
chalcone--flavonone isomerase 2
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    AT5G66220
Enzymes [BR:ath01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     AT5G66220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 174 aa AA seqDB search
MALPSISAKWKGKNAKELTESVPFFRQLVTGEFEKLARVTMKKRLTGIQYSEKVVENCEE
IMKASGKYTRSEAKAIDQFLMVFKNQDFPPGSSIIFAICPKGSLTIAFSKEERVPKTGKA
VIKNKLLGEAVLESMIGKNGVSPATRKSLAERLSKLMNKKDPYNEANVNVATKN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccgtcaatctccgctaagtggaaaggcaagaatgcaaaggagttgacggaa
tccgtccctttcttccgccaactcgtcacaggtgagtttgagaaattggcaagggtgacg
atgaaaaagaggttaacggggatacaatactcggagaaagtagtagaaaactgtgaggag
atcatgaaagcgtcagggaaatacacaagatccgaagccaaagccattgaccaattcttg
atggtcttcaaaaaccaagatttccctcccggctcttcaatcatcttcgctatctgtcct
aaaggctctctcacaattgcattttcgaaagaggagagagtcccgaaaactggaaaagcg
gttatcaagaataagttgttgggtgaggcagttcttgagtcgatgatagggaagaatggt
gtatcccctgcgacaaggaagagcctcgctgagagattatctaagctgatgaacaaaaaa
gacccgtacaacgaagctaacgtcaacgttgctacaaaaaattga

DBGET integrated database retrieval system