KEGG   Arabidopsis thaliana (thale cress): AT5G66570Help
Entry
AT5G66570         CDS       T00041                                 

Gene name
PSBO1
Definition
(RefSeq) PS II oxygen-evolving complex 1
  KO
K02716  
photosystem II oxygen-evolving enhancer protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    AT5G66570 (PSBO1)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    AT5G66570 (PSBO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 332 aa AA seqDB search
MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG
KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG
SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS
FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI
GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctctctccaatccaccgctacattcctccagtcggcgaagatcgccaccgct
ccttctcgcggaagttctcacctccgatcgactcaagccgtcggcaaatcttttgggctc
gaaacttcctcggctcgcctcacttgctccttccagtctgactttaaggacttcaccggt
aaatgctccgacgctgtcaaaatcgccggattcgctcttgccacctctgctctcgtcgtc
tcgggagcaagtgcggagggagctccaaagagattgacctatgatgagattcagagcaag
acatacatggaagtgaaaggaactggaacggctaaccagtgccctactattgacggtggc
tctgagactttctcgttcaaacccggaaagtatgcaggaaagaagttctgcttcgagcct
acttccttcaccgtcaaggcagacagtgtaagcaagaacgctcctccagagttccagaac
acaaagctcatgacccgtcttacctacacccttgacgagatcgaaggacccttcgaggtt
gcttcagacggaagcgtcaatttcaaggaagaagatggaatcgactatgctgcagtcaca
gtccaacttccaggaggtgaacgtgtgccattccttttcacagtcaaacagcttgacgcc
tcaggcaaaccagacagcttcaccggaaaattcttggttccatcgtaccgtggctcttcc
ttcttggacccaaagggccgtggtggatccacaggatatgacaacgccgtggcattgcca
gctggaggcagaggagacgaggaggagcttgtaaaggagaacgtgaagaacactgccgct
tcagtgggagagatcactctgaaagtgacaaagagcaagccggagacaggagaggtgatc
ggagtgttcgagagtcttcagccgtcggatactgacttgggtgctaaggtaccaaaggat
gtgaagatccaaggggtgtggtatggtcaacttgagtga

DBGET integrated database retrieval system