KEGG   Arabidopsis thaliana (thale cress): ArthCp030Help
Entry
ArthCp030         CDS       T00041                                 

Gene name
rbcL
Definition
RuBisCO large subunit
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:ath01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ath00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:ath00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CP
AA seq 479 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAVEGNEIIREACKWSPELAAACEVWKEITFNFPTIDKLDGQE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttgggttcaaagctggtgttaaagagtat
aaattgacttactatactcctgaatatgaaaccaaggatactgatatcttggcagcattc
cgagtaactcctcaacctggagttccacctgaagaagcaggggctgcggtagctgctgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagccttgatcgttac
aaaggacgatgctaccacatcgagcccgttccaggagaagaaactcaatttattgcgtat
gtagcttatcccttagacctttttgaagaaggttcggttactaacatgtttacctcgatt
gtgggtaatgtatttgggttcaaagccctggctgctctacgtctagaggatctgcgaatc
cctcctgcttatactaaaactttccaaggaccacctcatggtatccaagttgaaagagat
aaattgaacaagtatggacgtcccctattaggatgtactattaaaccaaaattggggtta
tccgcgaaaaactatggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgagaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagctatttataaatcacaggctgaaacaggtgaaatcaaagggcattatttg
aatgctactgcgggtacatgcgaagaaatgatcaaaagagctgtatttgccagagaattg
ggagttcctatcgtaatgcatgactacttaacagggggattcaccgcaaatactagtttg
tctcattattgccgagataatggcctacttcttcacatccaccgtgcaatgcacgctgtt
attgatagacagaagaatcatggtatgcacttccgtgtactagctaaagctttacgtcta
tctggtggagatcatattcacgcgggtacagtagtaggtaaacttgaaggagacagggag
tcaactttgggctttgttgatttactgcgcgatgattatgttgaaaaagatcgaagccgc
ggtatctttttcactcaagattgggtctcactacctggtgttctgcctgtggcttcaggg
ggtattcacgtttggcatatgcctgctttgaccgagatctttggagatgattctgtacta
caattcggtggaggaactttaggccacccttggggaaatgcaccgggtgccgtagccaac
cgagtagctctggaagcatgtgtacaagctcgtaatgagggacgtgatcttgcagtcgag
ggtaatgaaattatccgtgaagcttgcaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaagagatcacatttaacttcccaaccatcgataaattagatggccaagagtag

DBGET integrated database retrieval system