KEGG   Anaerolinea thermophila: ANT_00780Help
Entry
ANT_00780         CDS       T01410                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
atm  Anaerolinea thermophila
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ANT_00780 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    ANT_00780 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ANT_00780 (lacZ)
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ANT_00780 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(80970..84368)
Genome map
AA seq 1132 aa AA seqDB search
MTSLNDWENPAVQGIHREPMHATLLPYSDVADALRNERERSPYFLLLNGSWKFHFSPTPE
DAPAGFEAPDFDDSAWDTLPVPSNWQVLGYGIPRYLASSYAFDTSACPKVPHDTNETGSY
RLTFSVPETWRERQVFLVFEGVDSAFYVYLNGKMVGFSKDSRLPAEFNITPYLKEGENVL
AVRVFRWSDGSYLEDQDMWFLSGIFRDVYLIARPPAHIRDFVIHTPLTDDYRHARLEVTL
FLKNQSARSFQGLTLEAALYDPAGNPAHGWVRSATFDLLGESEETFVLSDDVPDAALWTA
ETPNLYTLILSLRDAHGNLLEVLRHPVGFRTVEVHDGKIFVNGSPIILRGVNRHEHLPQS
GHAITVESMIQDILLMKQANINAVRTSHYPNDPRWYDLCDQYGLYLIDEANIESHGLWDR
FAKDPAWRTAFLERGSRMVIRDRNHPSVIIWSMGNESGYGENHAALAEWMHTHDPTRPVH
YESARNEPYLDILSAMYPRLDQLVEYATAPGETRPFVLCEYAHAMGNSPGNLKDYWDIIE
TYPRLCGAFVWDWVDQGLERTTPDGRRWYAYGGDFGDSPSDFSFCCNGIVFPDRTPHPAY
WEVKKVYEPVRVEAVDALQGRLSLRNRYAFRDLSHLTLRWQVTSAGEVWQSGEMPVPPVS
AGESREIVLPLESLPDESKHEVILEVSFRLKEDEPWAPAGHEVAWEQIVLPIPRTAPLPV
PLEKMPALTVKEDGAQVTLNGGAVTACFDRAAGKLVSLQIEGRELLAQAPKVQIWRAPTE
NDLNTWGDERAALRWRAAGYDQLEESVSQVLFRALSPYSARMVVHSRLAVPNHITLPPFE
TAEQRLRLFQNGLNVYFDDAALDALIARLGVKDDLPKKVEKTARTQALVQVMAQSGRIAD
LLETARAFLLERGQSLPYDVQELLSRGVSDIYLPRAAFDLTTTYTFYTSGDLLIEVDFVP
AVSGLPFLPRLGIEAVLQPGMERVQWYGRGPHEAYSDRQESARVGVYQMHVDDLFVPYVV
PQENGTRSEVRWVCLRDEAGNGLGVCAEAPFFFSAHHYTVEDLAQARHPHELTRVPEVIL
HVDPFHSGLGSASCGPGRLERDQVKAEEHYFRLRLRPLMADDSPWALSRQRL
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgacttctttgaacgattgggaaaaccccgccgtgcagggcatccaccgcgaacccatg
cacgccacccttctgccgtattccgatgttgccgacgccctgcgcaatgagcgcgagcgc
agtccttacttccttttactgaacggttcgtggaaattccacttttcccctacccctgaa
gacgcccccgccggtttcgaagcccccgacttcgacgactcagcctgggataccctgccc
gtgccttccaactggcaggtgctgggctacggcatcccccgctatctggcgtccagttac
gccttcgataccagcgcctgccccaaagtgccgcacgacaccaacgagaccggttcgtac
cgcctgaccttctccgtgccggagacgtggcgcgagcgtcaggtcttcctcgtctttgaa
ggcgtggactcggcgttctacgtgtacctcaacggcaaaatggtcggcttcagcaaggac
agccgcctgcccgccgagttcaacatcaccccttacctgaaagagggtgagaacgtgctg
gcggtgcgcgtcttccgctggtcggacggcagttacctggaagatcaggacatgtggttc
ctctccggcatcttccgcgatgtctatctgattgcccgcccgccggcgcacatccgcgat
ttcgtcatccacacccccctcaccgatgactaccgccacgcccgcctggaagtgaccctc
ttcctcaagaaccagtccgcccgctctttccagggattgacgctggaagccgccctctac
gacccggcgggcaaccccgcgcacggctgggtgcgctcggcaacctttgacctgcttggc
gagtccgaggaaaccttcgtcctctccgacgatgtacccgatgccgccctgtggacggcg
gaaacccccaacctgtacaccctcatcctctccctgcgcgacgcgcacggcaacctgctg
gaagtcctgcgccacccggtgggcttccgcaccgtcgaggtacacgacggcaaaattttc
gtcaacggcagtcccatcatcctgcgcggcgtcaaccgccacgaacacctgccgcagagt
ggtcatgccatcaccgtagagtcgatgattcaggacatcctcttaatgaagcaagccaac
atcaacgccgtgcgcaccagccactaccccaacgacccgcgctggtacgacctgtgcgac
cagtacggcttgtacctgattgacgaagccaacatcgaatcccacggcttgtgggatcgc
tttgccaaagaccccgcctggcgcaccgccttcctggagcgcggaagccgcatggtgatt
cgcgaccgcaaccacccctcggtgatcatctggtcgatgggcaacgaatccggctacggc
gaaaaccacgccgcgctggcagagtggatgcacacccacgaccccacccgaccggtgcat
tacgaatcggcgcgcaatgagccttacctcgacatcctcagcgccatgtacccgcgcctg
gatcaactggtggagtacgccaccgcccccggcgagacccgcccctttgtgctgtgcgag
tacgcccacgccatgggcaacagtcccggcaacctcaaggactactgggacatcatcgag
acctacccgcgcctgtgcggcgccttcgtctgggactgggtggatcagggactggaacgc
accacccccgacggacggcgctggtacgcctacggcggcgactttggcgattccccctcg
gacttttccttctgctgtaacggcatcgtcttccccgaccgcaccccgcaccccgcctac
tgggaagtcaaaaaggtctatgagccggtgcgcgtggaagccgtggatgccctgcaggga
cgcctgagcctgcgcaaccgctacgccttccgcgacttgagccacctgaccctgcgctgg
caggtgaccagcgcgggcgaggtctggcagagcggcgagatgcccgttccgcccgtatcc
gccggcgaaagccgcgaaatcgtcctgccgctggagtctttgcccgacgaaagcaagcat
gaagtcattctggaagtatccttccgcctgaaagaggatgaaccctgggcgcccgccggt
catgaagttgcctgggagcaaattgtcctgcccatcccgcgcactgccccgctccccgtg
ccgcttgagaagatgcccgcgctgacggtcaaagaagacggcgcgcaggtcaccctcaac
ggcggcgcggtcacggcgtgcttcgaccgcgccgcggggaaactggtctccctgcaaatc
gaagggcgcgaactgctggcgcaggcgccaaaggtgcagatctggcgcgcgcccaccgaa
aatgacctcaacacctggggagacgagcgcgccgccctgcgctggcgcgccgcgggctac
gatcaactggaagagagcgtctcgcaggtgcttttccgcgccctcagcccttacagcgcg
cgcatggtggtgcattcgcgcctggcagtgccgaatcacatcaccctgccgccctttgaa
accgccgaacagcgcctgcgcctgttccagaacggcttgaacgtgtactttgacgatgcc
gccctggacgcgctgattgcccgcctgggagtgaaggacgacctgcccaagaaggtggag
aaaactgcccgcacccaagccctggtgcaggtgatggcgcagagcgggcgcatcgccgac
ctgctggaaactgcccgcgccttcctgctggagcgcggtcaaagcctgccctacgacgtg
caggaactgctctcccgcggggtgagcgacatctacctgccgcgcgccgccttcgacctg
accaccacctataccttctacaccagcggcgacctgctcatcgaggtggatttcgtcccc
gcggtgagcggcttgcccttcctgccgcgcctgggcatcgaagccgtcttacagcccggc
atggagcgggtgcagtggtacgggcgcggtcctcatgaagcctacagcgaccggcaggaa
agcgcccgcgtgggcgtgtaccagatgcacgtggatgacctgtttgtgccgtatgtcgtc
ccgcaggaaaacggcacccgcagtgaagtgcgctgggtgtgcctgcgcgacgaagccggc
aacgggctgggcgtgtgcgccgaagcccccttcttcttcagcgcccaccactacaccgtt
gaagacctcgcgcaagcccgccacccgcatgaattgacccgcgtgccggaagtcatcctg
cacgtggaccccttccactccggcttgggcagtgcctcgtgcggtcccggcaggctggag
cgggatcaggtgaaggcggaagagcattacttccgcctgcgcctgcgtccactgatggct
gacgactcgccctgggcgttgagccgccagcgcctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system