KEGG   Anaerolinea thermophila: ANT_00780Help
Entry
ANT_00780         CDS       T01410                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
atm  Anaerolinea thermophila
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:atm00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:atm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:atm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(80970..84368)
Genome map
AA seq 1132 aa AA seqDB search
MTSLNDWENPAVQGIHREPMHATLLPYSDVADALRNERERSPYFLLLNGSWKFHFSPTPE
DAPAGFEAPDFDDSAWDTLPVPSNWQVLGYGIPRYLASSYAFDTSACPKVPHDTNETGSY
RLTFSVPETWRERQVFLVFEGVDSAFYVYLNGKMVGFSKDSRLPAEFNITPYLKEGENVL
AVRVFRWSDGSYLEDQDMWFLSGIFRDVYLIARPPAHIRDFVIHTPLTDDYRHARLEVTL
FLKNQSARSFQGLTLEAALYDPAGNPAHGWVRSATFDLLGESEETFVLSDDVPDAALWTA
ETPNLYTLILSLRDAHGNLLEVLRHPVGFRTVEVHDGKIFVNGSPIILRGVNRHEHLPQS
GHAITVESMIQDILLMKQANINAVRTSHYPNDPRWYDLCDQYGLYLIDEANIESHGLWDR
FAKDPAWRTAFLERGSRMVIRDRNHPSVIIWSMGNESGYGENHAALAEWMHTHDPTRPVH
YESARNEPYLDILSAMYPRLDQLVEYATAPGETRPFVLCEYAHAMGNSPGNLKDYWDIIE
TYPRLCGAFVWDWVDQGLERTTPDGRRWYAYGGDFGDSPSDFSFCCNGIVFPDRTPHPAY
WEVKKVYEPVRVEAVDALQGRLSLRNRYAFRDLSHLTLRWQVTSAGEVWQSGEMPVPPVS
AGESREIVLPLESLPDESKHEVILEVSFRLKEDEPWAPAGHEVAWEQIVLPIPRTAPLPV
PLEKMPALTVKEDGAQVTLNGGAVTACFDRAAGKLVSLQIEGRELLAQAPKVQIWRAPTE
NDLNTWGDERAALRWRAAGYDQLEESVSQVLFRALSPYSARMVVHSRLAVPNHITLPPFE
TAEQRLRLFQNGLNVYFDDAALDALIARLGVKDDLPKKVEKTARTQALVQVMAQSGRIAD
LLETARAFLLERGQSLPYDVQELLSRGVSDIYLPRAAFDLTTTYTFYTSGDLLIEVDFVP
AVSGLPFLPRLGIEAVLQPGMERVQWYGRGPHEAYSDRQESARVGVYQMHVDDLFVPYVV
PQENGTRSEVRWVCLRDEAGNGLGVCAEAPFFFSAHHYTVEDLAQARHPHELTRVPEVIL
HVDPFHSGLGSASCGPGRLERDQVKAEEHYFRLRLRPLMADDSPWALSRQRL
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgacttctttgaacgattgggaaaaccccgccgtgcagggcatccaccgcgaacccatg
cacgccacccttctgccgtattccgatgttgccgacgccctgcgcaatgagcgcgagcgc
agtccttacttccttttactgaacggttcgtggaaattccacttttcccctacccctgaa
gacgcccccgccggtttcgaagcccccgacttcgacgactcagcctgggataccctgccc
gtgccttccaactggcaggtgctgggctacggcatcccccgctatctggcgtccagttac
gccttcgataccagcgcctgccccaaagtgccgcacgacaccaacgagaccggttcgtac
cgcctgaccttctccgtgccggagacgtggcgcgagcgtcaggtcttcctcgtctttgaa
ggcgtggactcggcgttctacgtgtacctcaacggcaaaatggtcggcttcagcaaggac
agccgcctgcccgccgagttcaacatcaccccttacctgaaagagggtgagaacgtgctg
gcggtgcgcgtcttccgctggtcggacggcagttacctggaagatcaggacatgtggttc
ctctccggcatcttccgcgatgtctatctgattgcccgcccgccggcgcacatccgcgat
ttcgtcatccacacccccctcaccgatgactaccgccacgcccgcctggaagtgaccctc
ttcctcaagaaccagtccgcccgctctttccagggattgacgctggaagccgccctctac
gacccggcgggcaaccccgcgcacggctgggtgcgctcggcaacctttgacctgcttggc
gagtccgaggaaaccttcgtcctctccgacgatgtacccgatgccgccctgtggacggcg
gaaacccccaacctgtacaccctcatcctctccctgcgcgacgcgcacggcaacctgctg
gaagtcctgcgccacccggtgggcttccgcaccgtcgaggtacacgacggcaaaattttc
gtcaacggcagtcccatcatcctgcgcggcgtcaaccgccacgaacacctgccgcagagt
ggtcatgccatcaccgtagagtcgatgattcaggacatcctcttaatgaagcaagccaac
atcaacgccgtgcgcaccagccactaccccaacgacccgcgctggtacgacctgtgcgac
cagtacggcttgtacctgattgacgaagccaacatcgaatcccacggcttgtgggatcgc
tttgccaaagaccccgcctggcgcaccgccttcctggagcgcggaagccgcatggtgatt
cgcgaccgcaaccacccctcggtgatcatctggtcgatgggcaacgaatccggctacggc
gaaaaccacgccgcgctggcagagtggatgcacacccacgaccccacccgaccggtgcat
tacgaatcggcgcgcaatgagccttacctcgacatcctcagcgccatgtacccgcgcctg
gatcaactggtggagtacgccaccgcccccggcgagacccgcccctttgtgctgtgcgag
tacgcccacgccatgggcaacagtcccggcaacctcaaggactactgggacatcatcgag
acctacccgcgcctgtgcggcgccttcgtctgggactgggtggatcagggactggaacgc
accacccccgacggacggcgctggtacgcctacggcggcgactttggcgattccccctcg
gacttttccttctgctgtaacggcatcgtcttccccgaccgcaccccgcaccccgcctac
tgggaagtcaaaaaggtctatgagccggtgcgcgtggaagccgtggatgccctgcaggga
cgcctgagcctgcgcaaccgctacgccttccgcgacttgagccacctgaccctgcgctgg
caggtgaccagcgcgggcgaggtctggcagagcggcgagatgcccgttccgcccgtatcc
gccggcgaaagccgcgaaatcgtcctgccgctggagtctttgcccgacgaaagcaagcat
gaagtcattctggaagtatccttccgcctgaaagaggatgaaccctgggcgcccgccggt
catgaagttgcctgggagcaaattgtcctgcccatcccgcgcactgccccgctccccgtg
ccgcttgagaagatgcccgcgctgacggtcaaagaagacggcgcgcaggtcaccctcaac
ggcggcgcggtcacggcgtgcttcgaccgcgccgcggggaaactggtctccctgcaaatc
gaagggcgcgaactgctggcgcaggcgccaaaggtgcagatctggcgcgcgcccaccgaa
aatgacctcaacacctggggagacgagcgcgccgccctgcgctggcgcgccgcgggctac
gatcaactggaagagagcgtctcgcaggtgcttttccgcgccctcagcccttacagcgcg
cgcatggtggtgcattcgcgcctggcagtgccgaatcacatcaccctgccgccctttgaa
accgccgaacagcgcctgcgcctgttccagaacggcttgaacgtgtactttgacgatgcc
gccctggacgcgctgattgcccgcctgggagtgaaggacgacctgcccaagaaggtggag
aaaactgcccgcacccaagccctggtgcaggtgatggcgcagagcgggcgcatcgccgac
ctgctggaaactgcccgcgccttcctgctggagcgcggtcaaagcctgccctacgacgtg
caggaactgctctcccgcggggtgagcgacatctacctgccgcgcgccgccttcgacctg
accaccacctataccttctacaccagcggcgacctgctcatcgaggtggatttcgtcccc
gcggtgagcggcttgcccttcctgccgcgcctgggcatcgaagccgtcttacagcccggc
atggagcgggtgcagtggtacgggcgcggtcctcatgaagcctacagcgaccggcaggaa
agcgcccgcgtgggcgtgtaccagatgcacgtggatgacctgtttgtgccgtatgtcgtc
ccgcaggaaaacggcacccgcagtgaagtgcgctgggtgtgcctgcgcgacgaagccggc
aacgggctgggcgtgtgcgccgaagcccccttcttcttcagcgcccaccactacaccgtt
gaagacctcgcgcaagcccgccacccgcatgaattgacccgcgtgccggaagtcatcctg
cacgtggaccccttccactccggcttgggcagtgcctcgtgcggtcccggcaggctggag
cgggatcaggtgaaggcggaagagcattacttccgcctgcgcctgcgtccactgatggct
gacgactcgccctgggcgttgagccgccagcgcctgtaa

DBGET integrated database retrieval system