KEGG   Anaerolinea thermophila: ANT_00850Help
Entry
ANT_00850         CDS       T01410                                 

Gene name
trpB
Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
atm  Anaerolinea thermophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:atm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:atm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:atm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(93692..95065)
Genome map
AA seq 457 aa AA seqDB search
MSNQTRFLLSENDIPRFYYNVLADSPVPPAPVLNPITREPVTPDFLSAIFPMEIILQEVS
QERYIEIPEPVREAYKLYRPTPLIRALRLEKALDTPAHIYYKYEGVSPSGSHKTNTALAQ
AFYNKISGTRAITTETGAGQWGSALSMACRFFGMDLEVYMVKVSYEQKPYRRFLMETYGA
QVFASPTTRTQAGRAILEKDPNSPGSLGIAISEAVEAAATSGGAKKYALGSVLNHVLLHQ
SVIGEEALKQMDMAGEYPDMVIGCVGGGSNFAGIAYPFLRYNLTEGRNTRLIAVEPKAAP
SLTRGVYGFDYGDTARMAPIVKMHTLGHDFIPPAIHAGGLRYHGMAPSLSAFYDAGLIEA
VAVGQRAVFEAAVLFTQQEGILPAPESSHAIRVAIDEALKCKETGEKKVILFNLSGHGHF
DLSAYNKYLSGQLEDYDFPEDAIATIAQRLPQVSIPA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccaaacccgttttttgctcagcgagaatgacatcccgcgcttttactacaac
gtcctcgccgacagtcccgttccccccgcgccggtgctcaatcccatcacccgcgagccg
gtcacgcccgacttcctctccgccatcttccccatggagattatcctgcaggaagtctcg
caggaacgctacattgaaatccccgaaccggtgcgcgaagcctacaaactctaccgcccc
accccgctgattcgcgccctgcgcctggaaaaagctctggacacccccgcgcacatttac
tacaaatatgagggcgtctcgccgtcgggcagtcacaagactaacaccgccctggcgcaa
gccttctacaacaagatttccggcacgcgcgccatcaccaccgagaccggcgccgggcag
tgggggtcggcgctctccatggcgtgccgcttcttcggcatggatctggaagtgtacatg
gtcaaggtctcttacgagcaaaagccctaccggcgcttcctcatggaaacctacggcgcg
caggtgtttgccagccccaccacgcgcacgcaggcaggacgcgccatcctggagaaagac
cccaacagccccggctcgctgggcatcgccatctccgaggcggtggaagccgccgctact
tccggcggggctaagaaatacgctcttggttcggtgctgaaccacgttctcctgcaccag
agcgtcatcggcgaggaagccctcaagcagatggacatggcgggcgagtaccccgacatg
gtgatcggctgtgtgggcggcggctccaattttgccggaatcgcctatcccttcctgcgc
tacaacctcaccgagggcaggaacacccgcctgattgccgtcgaacccaaagccgccccc
tcgctcacccgcggggtgtatggcttcgactacggcgataccgcccggatggcgcccatc
gtcaagatgcacaccctcggacacgacttcatcccccctgccattcacgccggcggactg
cgctaccacggcatggcgcccagcctctcggcgttttacgatgccgggctgattgaagca
gtggcggtaggtcagcgcgcggtgttcgaagccgcggtgctgttcacccagcaggaaggc
atcctgccggcacccgagtcctcgcacgccatccgcgttgccattgacgaagccctgaag
tgcaaagagaccggcgagaagaaggtcatcctcttcaacctctccggtcacgggcatttc
gatttgagcgcctacaacaagtacctcagcgggcagttggaagattacgacttccccgag
gacgccattgccaccatcgcgcaaagattgccgcaggtgtccatcccggcgtaa

DBGET integrated database retrieval system