KEGG   Anaerolinea thermophila: ANT_01360Help
Entry
ANT_01360         CDS       T01410                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
atm  Anaerolinea thermophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:atm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
154486..155091
Genome map
AA seq 201 aa AA seqDB search
MAGLPAPLEALITAFERLPGIGPKTASRLAFFILRQPDEVAQQLAEALLAVKSQTANCPV
CFNIMLAGQERCQICADPRRDESQLCVVEDPLDVLVIERTGGFLGRYHVLQGVLNPIEGI
GPEQLRIRPLIERVQEGRVREVIIATNPSMEGDATALYLRQQLAPLGVRITRLARGLPMG
GDLEYADQNTLLRALAGRQEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctggtttaccggcaccactggaagccctgattaccgcgtttgagcgtttgccgggt
atcggtcccaagacggcatcgcggctggcgttttttatcctgcgccagccagatgaagtg
gctcagcagttagccgaagccctgctggcggtgaaaagccagacggcaaactgcccggtg
tgttttaacatcatgctggcggggcaggaacgctgtcagatttgcgctgacccgcgccgc
gatgagtcgcagttatgcgtggtggaagacccgctggatgtgctggtgatcgagcgcacc
ggcggctttttggggcggtatcacgttctgcagggcgtgctgaaccccattgaaggcatt
ggaccggagcagttgcgcatccgcccgctcatcgaacgggtgcaggaaggcagggtgcgc
gaggtgatcattgccaccaaccccagcatggaaggcgacgccactgccctgtacctgcgc
cagcagttagccccgctgggcgtgcgcattacccggctggcgcgcggcttgcccatgggc
ggcgatctggaatacgccgatcagaacacccttctgcgggcgctggctggcaggcaggaa
ttgtga

DBGET integrated database retrieval system