KEGG   Anaerolinea thermophila: ANT_02900Help
Entry
ANT_02900         CDS       T01410                                 

Gene name
ribF
Definition
riboflavin kinase/FMN adenylyltransferase (EC:2.7.1.26 2.7.7.2)
Orthology
K11753  
riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
atm  Anaerolinea thermophila
Pathway
Riboflavin metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:atm00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
316954..317883
Genome map
AA seq 309 aa AA seqDB search
MKHIRSLDEFPRGRTYLTVGSFDGVHRGHQGLLSALAQAAHQAGAQSAVVTFFPHPVAVL
RGLSQPYYLTSPEERARLMGECGIDVVLTLPFTRELAALSAREFVTLLREKAGMESLWVG
YDFALGRNREGNVPALQRLGEELGFTVHVLPPVALEDIPVSSSLIRAALEQGDVVSAARM
LGRPYTIEGAVVHGDARGRTLNIPTINISFWAEQRLPAFGVYACRVEVEGLVLDAVANIG
IRPTFANPNGEVRLEAHLLDFSGDLYDRTVRLQFVAFLRPERRFESVEALVAQIQQDIQH
AREVLTHAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatattcgttcactggatgaatttccccgcgggcgcacctatttaacggtaggc
tcttttgatggcgtacaccgcggacatcagggtttgctcagcgcactggcgcaagccgcg
catcaggctggcgcacaaagtgccgtggtgaccttttttccccatcccgtggcggttctg
cggggattgtctcagccctactatctcacttctcccgaagaacgcgcccgcctgatgggc
gagtgtggcattgatgtagtgctgaccctgccttttacccgcgaactggcggcgctgagc
gcccgtgaatttgtcaccctgctcagggagaaagccggcatggagtccctctgggtgggt
tacgactttgccctcgggcgtaaccgcgagggcaatgtgcctgcacttcagcgtttgggt
gaggaattggggtttaccgttcacgttctgccgcccgtggcgctggaagatattccggtc
tcgtccagtttaatccgcgccgcactggaacagggcgatgtggtctctgccgcgcgcatg
ctgggacgcccctataccattgaaggcgcagtggttcacggggatgcccgcgggcgcacc
ctgaacattcctaccattaatatttccttctgggcggaacagcgcctgcctgcttttggc
gtctatgcctgccgtgtggaagttgaggggcttgtgctggacgcggttgccaacatcggc
atccgcccgacttttgccaatcccaacggcgaggtgcgcctggaagcccacttgctggac
ttttcgggcgatttgtatgacaggaccgtgcgcctgcagtttgtcgctttcctgcgccct
gaacgccgttttgaatcggttgaggcgctggtggcgcagattcaacaggacatccagcac
gccagggaggtgttgactcatgccgcttaa

DBGET integrated database retrieval system