KEGG   Anaerolinea thermophila: ANT_02900Help
Entry
ANT_02900         CDS       T01410                                 

Gene name
ribF
Definition
riboflavin kinase/FMN adenylyltransferase (EC:2.7.1.26 2.7.7.2)
Orthology
K11753  
riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
atm  Anaerolinea thermophila
Pathway
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ANT_02900 (ribF)
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     ANT_02900 (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     ANT_02900 (ribF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
316954..317883
Genome map
AA seq 309 aa AA seqDB search
MKHIRSLDEFPRGRTYLTVGSFDGVHRGHQGLLSALAQAAHQAGAQSAVVTFFPHPVAVL
RGLSQPYYLTSPEERARLMGECGIDVVLTLPFTRELAALSAREFVTLLREKAGMESLWVG
YDFALGRNREGNVPALQRLGEELGFTVHVLPPVALEDIPVSSSLIRAALEQGDVVSAARM
LGRPYTIEGAVVHGDARGRTLNIPTINISFWAEQRLPAFGVYACRVEVEGLVLDAVANIG
IRPTFANPNGEVRLEAHLLDFSGDLYDRTVRLQFVAFLRPERRFESVEALVAQIQQDIQH
AREVLTHAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatattcgttcactggatgaatttccccgcgggcgcacctatttaacggtaggc
tcttttgatggcgtacaccgcggacatcagggtttgctcagcgcactggcgcaagccgcg
catcaggctggcgcacaaagtgccgtggtgaccttttttccccatcccgtggcggttctg
cggggattgtctcagccctactatctcacttctcccgaagaacgcgcccgcctgatgggc
gagtgtggcattgatgtagtgctgaccctgccttttacccgcgaactggcggcgctgagc
gcccgtgaatttgtcaccctgctcagggagaaagccggcatggagtccctctgggtgggt
tacgactttgccctcgggcgtaaccgcgagggcaatgtgcctgcacttcagcgtttgggt
gaggaattggggtttaccgttcacgttctgccgcccgtggcgctggaagatattccggtc
tcgtccagtttaatccgcgccgcactggaacagggcgatgtggtctctgccgcgcgcatg
ctgggacgcccctataccattgaaggcgcagtggttcacggggatgcccgcgggcgcacc
ctgaacattcctaccattaatatttccttctgggcggaacagcgcctgcctgcttttggc
gtctatgcctgccgtgtggaagttgaggggcttgtgctggacgcggttgccaacatcggc
atccgcccgacttttgccaatcccaacggcgaggtgcgcctggaagcccacttgctggac
ttttcgggcgatttgtatgacaggaccgtgcgcctgcagtttgtcgctttcctgcgccct
gaacgccgttttgaatcggttgaggcgctggtggcgcagattcaacaggacatccagcac
gccagggaggtgttgactcatgccgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system