KEGG   Anaerolinea thermophila: ANT_04920Help
Entry
ANT_04920         CDS       T01410                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
atm  Anaerolinea thermophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANT_04920 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_04920 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ANT_04920 (thrC)
Enzymes [BR:atm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ANT_04920 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
525681..526781
Genome map
AA seq 366 aa AA seqDB search
MRGFLNTPDSSLYSGVLARYGAWMDLPAHTRPVTLLEGNTPLIPMPRLAQELGGGFELFV
KFEGMNPTGSFKDRGMTAAISEAFGRGVHTVICASTGNTAASAAAYAARAQMRAIVIIPE
GKVAAGKLAGAVAYGAQVIQIQGSFDDALSLVVEISERHPIALVNSLNPYRLEGQKTAAF
EIVDALGSAPDWLCLPVGNAGNITSYWMGFRQDHARRSSGLPRILGVQAEGAAPLVLGHP
VEHPETVATAIRIGKPARGEQALEAAEQSGGRIIAVSDAEILAMQRRLAGEGVWVEPASA
AGLAGLARQLREGKMRLSELRGRRVVAVCTGHGLKDPEIIAHNMPAPLRLPARMDALEEA
ILGVSR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggtttcttgaacacccctgattcttctctttattctggcgtgctggcgcgttat
ggcgcatggatggacttgcccgctcacacccgtccggtgaccctgctggaaggcaacacg
ccgctcatccccatgccgcggctggcgcaggaactgggcggcggcttcgaattgttcgtc
aaatttgagggcatgaacccgacgggttctttcaaagaccgcgggatgactgccgccatc
agcgaagcctttgggcgcggggtgcatacagtgatttgtgcctcgaccggcaacacggcg
gcatcggcggcggcatatgccgcccgcgcgcagatgcgtgccattgtcatcatccctgaa
ggcaaggtagcggcgggaaaactggcgggagcggtagcgtacggcgcgcaggtgattcag
attcaggggtcgtttgacgatgctttgagtctggtggtggagatttccgagcgtcacccc
atcgcgctggtcaattcgctcaacccctatcgtctggaagggcagaaaaccgccgcgttt
gagattgtggatgcgttggggagcgctcccgattggttatgcctgccggtgggcaatgcc
ggcaacatcacttcgtactggatgggcttccgtcaggatcacgcccgtcgttccagcgga
ctgccgcgcattctgggcgtacaggcagagggcgccgcgccgctggtgctggggcatccg
gtagagcatcccgaaacggtggcaaccgccatccgcatcggcaagcccgcccgcggcgag
caagccctggaagccgccgagcagtccggcgggcgcatcattgcggtgagcgatgccgaa
atccttgccatgcagaggcgtctggcaggcgaaggtgtgtgggtggagcctgcctcggcg
gctgggctggcgggacttgcccgccagttgcgcgaaggcaaaatgcgcctgagcgagttg
cgcggcaggcgggtggtggcagtgtgcaccggtcacgggctgaaagacccggagatcatt
gcgcacaacatgcccgctccccttcgtctgcccgcccgcatggacgcgctggaagaagcc
attctgggagtttcccgatga

DBGET integrated database retrieval system