KEGG   Anaerolinea thermophila: ANT_05060Help
Entry
ANT_05060         CDS       T01410                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
atm  Anaerolinea thermophila
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:atm00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:atm00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
538508..539674
Genome map
AA seq 388 aa AA seqDB search
MSDYTPKPEHKFTFGLWTVGSTGRDPFGAPTRDALSPVELVHLLAEVGAYGVNFHDNDLV
PIDATPAERDRIVRDFKNALKETGLVVPMATTNLFSDPVFKDGAFTSNDPKVRAYALQKT
MQAIDLGVELGAKVYVFWGGREGTESDATKNPVDAIKRTREALNFLCEYVLDQGYDLKFA
LEAKPNEPRGDIYNPTTGHMLAFIETLDHPEMVGVNPEVAHEHMAGLNFLHGVAQAWEAG
KLFHIDLNDQYPGRYDQDFRFGSRDLKAAFFLVKFLEDVGYSGSRHFDAHAYRTEDYEGV
KDFARGCMRTYLILKEKAARFNADPEIQALLAEINATEPSLESVFGAYSREKANRLKGMT
FDRVSLGKRGLKYERLDQLTIDLLLGVR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactatacccccaaacccgaacataaattcacctttggcttgtggacggtgggc
tccactggacgtgacccgtttggtgcgcctacccgtgatgccctcagcccggtggaactg
gtgcatttgctggcggaagtaggcgcttacggtgtgaactttcacgataatgacctggtg
ccgattgatgccacccctgccgagcgtgaccgcatcgtgcgcgacttcaaaaatgcgctg
aaggaaaccggtctggttgtgcctatggcgaccaccaaccttttcagcgatccggtgttc
aaggacggcgctttcaccagcaacgaccccaaagtgcgcgcctatgccttgcaaaagacc
atgcaagccattgatctgggcgtggaactgggggcgaaggtgtatgtcttctggggcggg
cgcgaaggcacggaaagcgatgccaccaagaaccccgtggatgccatcaagcgcacccgc
gaagccctcaacttcctctgcgagtatgtgctggatcagggctatgacctgaagtttgct
ctggaagccaaacccaacgaaccgcgcggcgatatctacaaccccaccaccggacacatg
ctggcgttcattgagactctcgatcacccggagatggtaggtgtcaacccggaggtggct
catgagcatatggcagggttgaatttcctgcacggcgtggcgcaggcatgggaagcgggc
aaactcttccacattgacctcaacgaccagtaccccgggcgctatgatcaggacttccgc
tttggctcgcgtgacctcaaagccgccttcttcctggtgaaattccttgaggatgtgggg
tatagcggctcgcgccactttgacgctcacgcctaccgcactgaggactacgagggcgtc
aaagactttgcccgcgggtgtatgcgcacttaccttattctcaaagaaaaagccgcccgc
ttcaacgccgatcctgaaattcaagccttgctggcggaaatcaacgccactgagccgtcg
ctggagagcgtcttcggagcctactcgcgcgaaaaagccaatcgccttaagggtatgacc
tttgaccgtgtgtcactgggtaaacgcgggttgaagtatgagcgcctggaccagttgacc
attgatttgctgttgggtgtgcgataa

DBGET integrated database retrieval system