KEGG   Anaerolinea thermophila: ANT_05360Help
Entry
ANT_05360         CDS       T01410                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
atm  Anaerolinea thermophila
Brite
Enzymes [BR:atm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ANT_05360
Transfer RNA biogenesis [BR:atm03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    ANT_05360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
575539..577137
Genome map
AA seq 532 aa AA seqDB search
MDFEVWQETHEPTPERQEIARRVLEDVRRGMDVVRALRRHPLPEGGYLPKSILVQTYQRL
VEQGEWQEDAHFLAAIRMKPVRTLSGVTTVTVLTKPYPCPGKCIFCPTDVRMPKSYLPDE
PGAMRGLQNEFDPYRQVASRLESLAATGHPTDKIELLILGGTFTAYRRDYQEWFIRRCFD
ALNEVDSARLEEAHRRNETAPHRNVGLVIETRPDEITPQELAWLRRLGVTKVQMGVQSLD
DRILALNQRGHTAAEALQATALLRAAGFKIVLHWMPNLLGATPQSDREDFARLWTQGYAP
DEIKIYPCQLLQNADLYAYWERGEYQPYTTEELIDLIADLKPTVPEYCRINRIIRDIPST
NVVAGNRRTSLRQDVLAEVARRGQRCHCIRCREVRNERVDPNTLVLRDLTYTAAYAEEHF
LQFVTPQDRIAGYLRLSLPLPDAPDVTSALPDLEGAALIREVHVYGQSLPVGFELPGAAQ
HIGLGTQLLNRAADLARARGFRRLAVIAAIGTRLYYESRGFQRGGLYLIRDL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaggtctggcaggaaacccacgaacccaccccggaacggcaggaaattgcc
cgccgtgtgctggaagacgtgcgccgcggcatggacgtggtgcgcgccctgcgccgccat
cccctgccggagggcggttacctgcccaaatccattctggtgcagacttaccagcgcttg
gtggagcagggcgaatggcaggaagatgcccatttcctcgccgccatccgcatgaagccg
gtgcgtaccctctccggcgtgaccacggtgacggtgctgaccaagccttacccctgcccg
ggcaaatgcatcttctgccccaccgatgtgcgcatgcccaagagttacctgcccgacgaa
cccggcgccatgcgcggtctgcagaacgagttcgatccctaccgccaggttgccagccga
ctggaatcgctggcggcaaccggacaccccaccgataaaatcgaactgctgattctggga
ggtacgttcactgcctaccgccgcgattatcaggagtggttcatccggcgctgttttgat
gccctcaacgaagtggactcggcgaggctggaagaagcccaccggcgcaacgaaaccgcc
ccgcaccgtaatgtggggctggtcatcgagacccgtccggatgaaatcaccccgcaggaa
ctggcgtggctgcgccgcctgggggtaaccaaggtgcagatgggcgtgcagtcgctggat
gaccgcattctggcgctcaatcagcgcgggcatactgccgccgaagccctgcaagccacc
gcgctcttgcgcgccgcgggcttcaagatcgtcctgcactggatgcccaatctgctgggc
gcgaccccgcagagcgaccgtgaggacttcgcccgcttgtggacgcaggggtacgccccg
gatgagattaagatttacccctgccaactgctccagaatgccgatttatacgcctactgg
gagcgcggcgagtaccagccctacaccaccgaagaactcattgacctgattgccgacctc
aagcccaccgtgccggagtactgccggattaaccgcatcatccgtgacatcccttcgacc
aacgtggtggcgggcaaccgccgcaccagtctgcggcaggatgtgctggcggaagttgcc
cgccgcggacagcgctgtcactgcatccgctgccgcgaggtgcgcaacgagcgcgttgac
cccaatacacttgtcctgcgcgacctgacctacaccgccgcgtatgctgaggaacatttc
ttacagtttgttacccctcaggatcgcattgccgggtatttgcgcctttccctgcctctg
cccgatgccccggatgtcacctctgccctgcctgacctggaaggcgccgccctgattcgc
gaggtgcacgtgtacggacagtccctgccggtggggtttgaactgcccggcgccgctcag
cacatcggcttgggtacgcagttgctcaaccgcgccgccgaccttgcccgcgcacgtgga
ttccgccgcctggcggtcattgccgccatcggcacgcgcctgtattacgaatcgcgcggc
ttccagcgcggcggactttacctgattcgcgatctctag

DBGET integrated database retrieval system