KEGG   Anaerolinea thermophila: ANT_05380Help
Entry
ANT_05380         CDS       T01410                                 

Definition
(GenBank) putative magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
atm  Anaerolinea thermophila
Pathway
atm00860  Porphyrin and chlorophyll metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ANT_05380
Enzymes [BR:atm01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ANT_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM Sigma54_activat AAA_16 AAA_22 AAA
Motif
Other DBs
NCBI-ProteinID: BAJ62572
NITE: ANT_05380
UniProt: E8N127
Position
578686..579783
Genome map
AA seq 365 aa AA seqDB search
MPPIYPFTAIVGQERMKRALVLNAVDPRIGGVLIRGERGTAKSTAARALAALLPKVKVVS
DCRFGCDPDAPATWCTECRERAERGESLPVSLRQIPFINLPVSATEDRVVGTLDIEAAIQ
RGERHFEPGVLAAANRGLLYIDEVNLLDDHVVDVLLDAAAMGMNIVEREGISFTHPARFI
LVGTMNPEEGDLRPQLLDRFALSVEIYGIRDARERVMIMERNLAFEKDPLAFVAHWQPKE
QELSQQIEQARKLLDQVTYTSRDLLSIASLTASLQVDGHRPDLVILKTARAHAAFEGRTS
ITARDIALAAELALPHRLKRTPFQQASATMEELAERIEQLQGGATSGEPREHPGGMEEES
GQKKT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctatttatccattcactgccatcgttggtcaggagcgcatgaagcgcgcactg
gtgctcaatgcggtggatccgcgtattggtggggttttgattcgcggcgagcgcggcacg
gcaaaatccacggcggcgcgcgccctggcggcactgcttcccaaggtcaaggtggtgagc
gactgccgttttggatgcgacccggacgccccggcgacatggtgcaccgaatgccgtgag
cgtgccgagcgcggcgaatccctgccggtgagcctgcgtcaaattcctttcatcaacctg
ccggtatctgccaccgaagaccgtgtggtgggtacactggacattgaagccgccatccag
cgcggcgaacgccattttgagccgggcgtgcttgccgccgctaaccgcggtttgctttac
attgacgaggtcaacctgctcgatgaccacgtggtggacgtactgctggatgccgccgct
atggggatgaacatcgttgagcgcgagggcatttccttcactcatccggcgcgcttcatc
ctggtcggcacgatgaaccctgaagagggtgacctgcgcccgcaactgctggaccgcttt
gccctctcggtggaaatctacggcatccgcgatgcccgcgagcgggtgatgatcatggag
cgcaacctggcgtttgaaaaagacccgctggcgtttgtggcgcactggcagcccaaagaa
caggaactctctcagcaaattgaacaagcccgcaaactgcttgatcaggtcacctatacc
agccgcgacctgctttcgattgcttcgctgaccgcctcattacaggtggatggtcaccgt
cccgacctggtcatcctgaagaccgcccgggcgcacgccgcttttgaagggcgcacgtcc
atcaccgcgcgggatattgccctggcggcagaactggcgctcccgcaccgcctgaagcgc
acccccttccagcaagcctcggcaaccatggaagaactggcggagcgcattgagcaactg
cagggcggcgccacctcaggcgagccgcgcgaacaccccggcggcatggaagaggaatcc
gggcaaaaaaaaacgtaa

DBGET integrated database retrieval system