KEGG   Anaerolinea thermophila: ANT_05420Help
Entry
ANT_05420         CDS       T01410                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
atm  Anaerolinea thermophila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ANT_05420 (rbsK)
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ANT_05420 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
583998..584909
Genome map
AA seq 303 aa AA seqDB search
MSGTLVIVGSLNMDLVVRAPRHPQPGETLIGSSFQTFPGGKGANQAVAAARLGAKVRMIG
RVGQDAFGDALLATVQRDGVDTTFIRRDPQAPTGVALITLDAKGQNTIVVASGANGNVSA
EDVRQSAQAFEGADVLLVQLECPLEAVQTAVQLAHQAGIIVVLNPAPAQPLPAELLQMVD
YLIPNQHELTLLAGGISDREQAIRHLQAQGVRYLVVTLGEEGALLALGEDRLILPAYPVE
VVDTVAAGDAFAGAFALALAEGKTPLDAACWGNAAGAIAVTRPGAQPSLPTRQEVEQFLK
ERT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaacgctggtgattgtgggaagtttgaacatggatctggtggtgcgcgcgccg
cgccaccctcaacccggtgaaaccctcatcgggagcagttttcagacctttcccggcggc
aagggcgccaatcaagccgtagccgcggcgcggctgggcgcaaaggtgcgcatgattgga
cgggtggggcaggatgcctttggcgatgccctgctggcaaccgttcagcgcgacggtgtg
gataccaccttcatccgccgcgacccgcaagcccctaccggcgtggcgctcatcaccctc
gatgctaaagggcagaacaccattgtggtggcttcgggcgccaacggcaacgtttccgct
gaggatgtgcgccagtcggcgcaggcgtttgagggggcggatgtcctgctggtgcagttg
gagtgtccgctggaggcggtgcagactgccgtgcaactggcgcatcaggcaggcataatt
gtggtgctgaaccccgcgcctgcccaacccctgcccgcggaactgttgcaaatggtggat
tacctcatccccaatcagcatgaactcaccctgctggcggggggaatctccgaccgcgaa
caagccatccgtcatttgcaggcgcagggggtgcgctatctggtggtgacgctgggcgaa
gagggcgctctgctggcgctgggcgaggatcgcctgattctgccggcttatccggtggaa
gtggtggataccgttgccgcaggcgatgcctttgccggagcctttgctctggcattggcg
gaaggcaagacgcctctggatgccgcctgctggggcaatgccgcaggtgcgattgccgtc
acccgtcccggcgctcagccctctctgcccacccgtcaggaagtggagcaatttttgaag
gaaaggacatag

DBGET integrated database retrieval system