KEGG   Anaerolinea thermophila: ANT_05540Help
Entry
ANT_05540         CDS       T01410                                 

Definition
putative aminopeptidase (EC:3.4.11.-)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
atm  Anaerolinea thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANT_05540
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ANT_05540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
596270..597268
Genome map
AA seq 332 aa AA seqDB search
MKALIQKLVETVGPSGYEEKVREVVRAEIEGLADEIKVDALGNLIARKGSRSEGGMRIAI
SAHMDEIGVIATHVDENGFVRFTTIGGVSPRTCIGGRVQFLNGTRGVIYMESLESATALP
TLDQLYIDVGASSRETCPVKVGDIAAFDRPFMELGDRLVSKAMDDRISVAVMIQALKELS
STPHELYFIFSTQEEVGLRGATTAAYGVDPELALAVDVTRTGDTPKGVKMEVALGKGPAI
KVRDSGMLSDPRVIRWMVETAEKAGIPYQLEVLEGGTTDARAMQLTRAGVPAGCLSIPTR
YIHSPSEMVDYQDVLQSVRLLVALLSAPVTLK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattaatccaaaaactggtagagaccgtaggaccttccggctacgaagaaaag
gtgcgcgaggtggtgcgcgcggaaattgaaggcttggcggatgaaatcaaggtggatgcg
ctgggcaacctgattgcccgcaagggaagccgttcggaaggcggtatgcgcatcgccatt
tctgctcacatggacgagattggtgtgattgccactcatgtggatgaaaatggctttgtg
cgctttaccaccattggcggcgtctctccgcgcacgtgcattggcgggcgggtgcagttc
ctcaacggcacgcgcggcgtgatttacatggaaagcctggaaagtgccaccgctctgccc
acgctggatcaactgtatattgacgtaggcgcgtccagccgcgaaacctgcccggtgaag
gtgggagatattgccgcgtttgaccgtcccttcatggaactgggcgaccgcctggtttcc
aaagccatggatgaccgcatcagcgtggcggtgatgattcaagccctgaaggaactctcc
agtaccccgcatgaactgtatttcatcttcagcacgcaggaagaggttggactgcgcggc
gctaccaccgcggcgtacggcgtggatcccgaactggcgctggcggtggatgtgacccgc
accggcgatacccccaagggcgtcaagatggaagtggcgctgggcaaaggacctgccatc
aaggtgcgcgacagtggcatgctctccgacccccgtgtcatccgctggatggtggagacg
gcggagaaagccggtatcccctatcaactggaagtgctggaaggcggcacgacagatgcc
cgtgccatgcagttaacccgcgccggcgttccggcgggatgtctttccatcccaacgcgc
tacattcacagcccctctgaaatggtagattatcaggatgtcctgcagtcggtgcgcttg
ctggtggctttgctaagcgccccggttaccctgaaatga

DBGET integrated database retrieval system