KEGG   Anaerolinea thermophila: ANT_05890Help
Entry
ANT_05890         CDS       T01410                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
atm  Anaerolinea thermophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANT_05890 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_05890 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANT_05890 (trpA)
Enzymes [BR:atm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ANT_05890 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(636504..637331)
Genome map
AA seq 275 aa AA seqDB search
MSGIKRIAQIFEKARNQQRAALILYYPAGYPDYATSLEVLKGLAQSGADLLEVGMPFSDP
LADGPTIQHATQMALSQRMNTRHCLALVRELRQQGVETPVVLMGYLNPVMAYGMERFVRD
ARQTGADGIILPDFPPEESADFRALCDAYELALISLVSPATPPERARQIAETTRGFLYLI
SLTGVTGARESLPPELEAFVARTRAVARVPLAVGFGISTPQQARRVSQIADGVIIGSALI
ARTGEAANPVQAAVEFIQQMFTALGKEELPRFESL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcaaaagaattgcgcagatctttgaaaaagcccgcaaccaacagcgggca
gcactgattctgtactacccggcaggatacccggactacgccacttcgctggaagtactg
aaggggctggcgcaaagtggagcagatcttctggaggtgggcatgcccttctcggacccg
ctggcagatggtcccactattcaacacgccacccagatggcgctgtcgcagcgaatgaac
acccgccactgtctggcactggtacgggaactgcgccagcaaggtgtagaaacgcctgtg
gtgctgatggggtatctcaatccggtgatggcatatggcatggagcgctttgtgcgagat
gcccgccagaccggcgctgatggcatcatcctgcccgatttcccgccggaggaaagcgcc
gacttccgcgccctgtgtgacgcttatgaactggcgttgatctcactggtttcccctgct
acaccaccggaaagagcgcgccagattgccgaaaccacgcgggggtttctctacctgatc
tcgctgactggcgtcaccggggcaagagaatcccttccccccgaactggaggcattcgtt
gcccgcacgcgcgccgtagcgcgggtgcctctggcggtgggatttggcatcagcacacct
cagcaagcccggcgcgtcagccagattgccgatggggtcatcattggctcggcactgatt
gcgcggactggagaggcggcaaacccagtccaagccgccgttgaatttatccagcaaatg
tttaccgcgctgggtaaagaggaactgccacgctttgaatctctttga

DBGET integrated database retrieval system