KEGG   Anaerolinea thermophila: ANT_05900Help
Entry
ANT_05900         CDS       T01410                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
atm  Anaerolinea thermophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANT_05900 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_05900 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANT_05900 (trpB)
Enzymes [BR:atm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ANT_05900 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(637328..638548)
Genome map
AA seq 406 aa AA seqDB search
METLSLIPTQQKDGRFGIFGGQYIPEVLMPAVQELEETYRQTRNDAEFHEIYTHLLKTYV
GRPTPLTFAKRLTEELGGARIYLKREDLTHTGAHKINNALGQALLAKRMGKTRLVAETGA
GQHGVATATVAALLDMECVVYMGSVDIARQQPNVQRMKLLGAEVRAVESGTRTLKDAVNE
AIRDWVTNVRTTHYLLGSALGPHPYPTIVRDFQAVIGREAHAQILEAEGRLPDACIACVG
GGSNAIGLFSAFVDDEEVALIGVEAGGEGIASGKHAARFADPARGKPGVLHGTFTYLLQD
EDGQVLPTHSISAGLDYPAVGPEHAYLREIGRAEYTSVTDAEALQAFQTLARTEGILPAL
ESSHALAEAIRRAPSLPRESILLVNLSGRGDKDLETVLKALKGRGA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctttcactaattcccacacaacaaaaagacgggcgctttggcatttttggc
ggacaatacatccccgaggtgctcatgcctgctgtgcaggaactggaagaaacctaccgc
cagacccggaacgatgctgagtttcacgaaatctatacgcatctactgaaaacctacgtg
ggacgccccaccccgctcacctttgccaaacgcctgaccgaagaactgggcggagcacgc
atttacctgaaacgcgaagacctgacgcacaccggcgcgcacaaaatcaacaacgccctg
gggcaagccctgctggcaaaacgcatgggcaaaacccgcctggtcgccgagacaggcgcc
ggtcagcacggtgtagctaccgccacggttgccgctctgctcgacatggaatgcgtggtt
tatatgggcagtgtagacatcgcccgacaacagcccaatgtgcaacgcatgaaactgctg
ggtgcagaggtacgtgctgtggaaagcggcacccgcacgctgaaagatgccgtcaacgaa
gccatccgcgattgggtgaccaacgtgcgcaccacgcactacctgctgggttcggcactg
ggaccgcatccctaccccaccattgtgcgcgactttcaagccgtaatcgggcgggaagcc
cacgcgcaaattctggaagccgaaggacgcctgccggacgcctgtatcgcctgcgtaggg
ggtggctccaacgcgattggattgttcagcgcctttgtggacgatgaagaggtagccctg
ataggcgtggaagccgggggcgagggtattgccagcggaaagcacgccgcgcgctttgcc
gaccctgcacgtggaaagccaggcgtcctgcatggtaccttcacctacctgcttcaggat
gaagatgggcaggtactgcccacccattccatctccgccgggctggactaccccgcggtg
ggtcctgaacatgcctatctgcgggagataggacgggcagagtacaccagcgtgaccgac
gcagaagccctgcaagccttccaaacccttgcccgtactgagggcattttgcccgccctg
gagtcatcccatgcgctggcagaagctatacgccgcgcccccagcctgccccgtgaaagc
atcctgctggtgaatctctccgggcgcggggacaaggacctggaaacggttctcaaagcc
ctgaaaggcaggggggcatga

DBGET integrated database retrieval system