KEGG   Anaerolinea thermophila: ANT_08810Help
Entry
ANT_08810         CDS       T01410                                 

Definition
putative alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
atm  Anaerolinea thermophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ANT_08810
  Lipid metabolism
   00561 Glycerolipid metabolism
    ANT_08810
   00600 Sphingolipid metabolism
    ANT_08810
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ANT_08810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(973155..974555)
Genome map
AA seq 466 aa AA seqDB search
MPKIAFIGAGSTVFAKNLLGDILSFPELADSTISLMDIDETRLNTTRLVAERIARTLGAH
PTIEATTDRRKAVAGADYVITMFQIGGYRPSTVIDFEIPKKYGLRQTIADTLGIGGIMRA
LRTIPVLLDLAKDMEELCPQALLLNYVNPMAMNMWALNRASKIRNVGLCHSVQGTAMQIA
QDIGVPIEEINYLCAGINHMAFYLKFERKTPQGVEDLYPRIHQVYKEGRVPDWNRVRYEM
LKRLGYFVTESSEHFSEYVPWFIKRDRPDLIEKFNIPLDEYIRRCEVQIAGWEATKDVVE
NPNLPINVPLIQEKLRAAGATDWDINWITEIASKFDQIEKSHEYGSYIIHSLETGIPRVI
YGNVENRGLIDNLPQGCTVEVPCLVDKNGIQPTKIGMLPPQLAALMQTNINVQALTVEAA
LTGKREHIYHAAMLDPHTAAELDLDQIWSLVDDLIEAHGDMLPPFH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaattgcttttatcggagccggaagcacagtctttgctaagaatctgctggga
gatatcctcagttttccggaactggctgactccaccatctcattgatggacattgacgaa
acccgcctgaataccacccgactggtggcagagcgcattgcccgaacgctgggagcgcat
cctaccatcgaagccaccaccgaccggcgcaaagccgtggctggggcagattacgtcatc
accatgttccagattggcggttaccgccccagcacggtgattgacttcgagattcccaaa
aagtacggcttgcgccagaccatcgccgatacgctgggcattggcggtatcatgcgtgcc
ctgcgcaccattcccgtcctgctagatctggcaaaggatatggaagaactgtgcccgcag
gctctcttgcttaactacgtcaaccccatggcaatgaacatgtgggcgctcaaccgcgcc
agcaagattcgcaacgtgggtttgtgccattcggtgcagggaaccgccatgcagattgcc
caggacatcggcgtgcccattgaggaaatcaactacctgtgcgcaggcatcaatcacatg
gcgttttacctgaaatttgagcgcaagaccccgcaaggcgtggaagacctgtacccgcgc
attcatcaggtatacaaagaagggcgcgtgcccgattggaaccgcgtgcgttacgaaatg
ctcaaacgcctggggtactttgtcaccgaatccagcgaacacttcagcgaatacgtgccc
tggttcatcaagcgcgaccgtccagacctcattgagaagttcaacattccgctggatgag
tacatccgccgttgcgaggtacagatagccggatgggaagccaccaaagacgtggtggaa
aaccccaacctgcccatcaacgtccccttgattcaggaaaaactgcgcgcagcgggtgct
accgattgggacatcaactggataaccgagatagcatccaaatttgatcaaattgaaaag
tcccacgaatacggctcttacatcatccactcactggaaacaggcatcccgcgggtgatt
tacggtaacgtggagaaccgcgggctgattgacaacctgccgcagggatgcaccgtggaa
gtgccctgtctggtggacaagaacggcatccagcccaccaagattggcatgttaccaccg
caactcgccgcgctgatgcagaccaacatcaatgtgcaagccctgaccgtagaagccgcg
ttgaccggcaagcgcgaacacatttaccatgccgccatgctcgatccgcacaccgccgcc
gaactggatctggatcaaatctggagtctggtggatgatctgatcgaagcccatggcgat
atgttaccgccattccattag

DBGET integrated database retrieval system