KEGG   Anaerolinea thermophila: ANT_11590Help
Entry
ANT_11590         CDS       T01410                                 

Definition
phosphotransferase (EC:2.7.1.-)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANT_11590
   01230 Biosynthesis of amino acids
    ANT_11590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_11590
   00030 Pentose phosphate pathway
    ANT_11590
   00051 Fructose and mannose metabolism
    ANT_11590
   00052 Galactose metabolism
    ANT_11590
  Energy metabolism
   00680 Methane metabolism
    ANT_11590
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ANT_11590
Protein phosphatases and associated proteins [BR:atm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ANT_11590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1292235..1293404
Genome map
AA seq 389 aa AA seqDB search
MTKTIGILTGGGDVPGLNPAIKSVAMGAFEMGYRVLGIRRGWGGLLNYNLDEPSTHDYYI
KELTRDSVRTIDRTGGTFLHTSRTNPQKVSPKSTPDFLKNSKWGKPIKDSEDMDYTDYVM
KVISHLGIDVLVPIGGDDTLSFAVRLHREGVPVVAIPKTMDNDVFGTDYCIGFSTAVTRS
VEFITNMRTSVGSHERIGVIELFGRNSGETSLISAYLAYVDRAIISEVPFNIEKLANFLL
EDKRNNPSNYAIMTISEGAIMEGGEIIESGEADAYGHRKLGGIGLITAEMIKKITGQNIM
YQQLGYLMRSGAPDSLDRMVAMSFGNLAIQLIRRNETGKMVALHGGKYTTVPVEMVLAGK
KRVDVASFYDIEQYRPRVKDFMGVPMFLS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacgattggtatcttaacaggcggtggggatgtccctggattgaaccctgcc
attaagtccgtggcgatgggcgcatttgaaatgggctatcgtgtccttggaattcgccgc
ggttggggtggtctgttaaattacaatctggatgagccttccacccatgattattacatt
aaggaattgacgcgcgactcggttcgtacgattgaccgtacaggcggtaccttcctgcat
acctcgcgcaccaatcctcagaaagtttcaccaaaaagcacccctgatttcctgaaaaat
tcaaaatggggaaagcctatcaaagactctgaggatatggattacaccgattatgttatg
aaggtcatttctcatctgggaattgacgtgctggtgcccattggtggcgatgatacgctg
tcattcgcggtgcgtttgcaccgtgaaggggttccggtggttgccattcctaaaactatg
gacaacgatgttttcggcaccgattactgtatcggattctccacagcggttacccgttca
gtcgagttcattaccaacatgcgcaccagtgttggttcccatgaacgaattggcgtaatt
gaactgtttggacgtaattctggtgaaaccagtttgatcagtgcctaccttgcttatgtg
gatcgagcgataatcagtgaagtgcccttcaatatcgagaaactggcgaatttcctgctg
gaagataagcgcaataatccctcgaattatgccatcatgaccatttccgaaggtgcaatc
atggaaggtggcgagattatcgaatccggtgaagccgatgcctatggacatcgcaaactg
ggtggtattggtctgattaccgctgagatgattaagaagatcaccgggcaaaacatcatg
taccagcagttgggttacctgatgcgctccggcgcgcccgattcactcgaccgtatggtt
gcgatgtccttcggcaatctggcaattcagttgattcgccgaaatgagaccggcaagatg
gtggctctccatggcggtaagtacaccactgttccggtggaaatggtgctggcgggaaag
aaacgagtggatgtcgcttcgttctatgatattgaacagtaccgtccgcgtgtcaaggat
ttcatgggcgtgcccatgttcttgagttga

DBGET integrated database retrieval system