KEGG   Anaerolinea thermophila: ANT_11650Help
Entry
ANT_11650         CDS       T01410                                 

Definition
magnesium chelatase, ChlI subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
atm  Anaerolinea thermophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:atm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1296915..1298099)
Genome map
AA seq 394 aa AA seqDB search
MSEHPSFEIPEPKDYLLTRTVKSLKELVDLVSGKAFQSEVNREDAGLAEIMPFPFLALVG
QQEMKLALLLAIINPLVNGVLLIGPRGTGKTTTARSLIDLLPEVQRSTCFYGCLPEDIEQ
GGMDAVCPDCAKKYAEGIPLTRTDRVRLIELPLNAKLEDVVGALDEHAPGHLRMRIRRGI
LAQADQNVLYVDEVNLLSDDIINAILDAASSGTYTLRRNLVAATYRSRFTLVGSMNPEEG
NLRPQIMDRFGLRVVVHGLDNLDERLEAYRRARAYRLNPRATVAQYAEETAQARAEIQVA
RSLLSKVEIPTEVARAGSELVRQFQVESLRAEITLFEAARAYAAADGRTTVTMEDIKMVA
PMALRLRRSAFMIQYFREQSREEEEMRKILDTLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcatccttcattcgagattcctgagccaaaagattacctgctgacccgtaca
gtcaaatcgctcaaagaactggtcgatctggttagcggcaaagccttccagtccgaagtc
aaccgcgaagacgctggactggcagagatcatgccgtttccattcctggcactggtcggt
cagcaggaaatgaaactggcacttttgcttgctatcatcaaccccctggtgaatggggtg
ttgcttattggaccgcgcggaacgggaaagaccaccactgcccgcagtttgatagacctg
ctcccggaggtgcagcgcagcacctgtttttacggatgtctgccagaagatattgaacag
ggtggaatggatgcggtttgtcctgattgcgccaagaaatacgccgaaggcatccctctc
actcggacggaccgagttcgcctgattgaattgcctctaaacgccaaactggaagatgtg
gtgggcgccctggatgaacacgctcccggacacctgcgcatgcgcattcgccggggcatt
ctggctcaggctgaccagaatgtgctgtatgtggatgaagtcaacctgctaagcgatgac
atcatcaacgccattctggatgcggcatcttcgggaacctatactctgcggcgcaatctg
gtggctgcaacctaccgctcgcgattcactctggtaggttcgatgaaccctgaagaaggc
aacctcaggcctcaaatcatggatcgtttcgggctacgggtggtcgtacacgggttagat
aaccttgacgagcgattggaagcctaccgccgcgctcgcgcgtaccggctgaatccccgc
gcaaccgttgcccagtatgctgaagaaactgcccaggcacgagccgagattcaggtagcg
cgttccctcttgtccaaagtagagattcctaccgaggtcgcccgcgcgggttcagaactg
gtaagacaatttcaggtggagtccctccgagcagagattaccctgtttgaagccgcccgc
gcctatgccgccgcggatggaagaaccactgtaaccatggaagacatcaagatggtggcg
cccatggctttgcgcctgagacgctctgccttcatgatacaatacttccgggagcaatcc
cgcgaagaagaagaaatgcgaaaaattctcgatacattatcctga

DBGET integrated database retrieval system