KEGG   Anaerolinea thermophila: ANT_11770Help
Entry
ANT_11770         CDS       T01410                                 

Definition
putative threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
atm  Anaerolinea thermophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANT_11770
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_11770
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ANT_11770
Enzymes [BR:atm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ANT_11770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1308468..1310150)
Genome map
AA seq 560 aa AA seqDB search
MPSHVIVECLDCGHKAPFSIVQPACPQCGSMWREARYDYDELATTLAQRLSSRPFDIWRY
RELLPVENPRPELSMGEGGTPLIRATNLGMMLGNPNIYVKDERQGPTASFKDRQASVTVA
TLKEAGVSEFVIASTGNVAISYSAYSARAGIKLWAFLTSLVPAAKMREVAIYGTQVIKIT
GSYDQAKKVAAEFAQQRHLSIDLGARTVPCIESMKTIAFEIAEQLTNLMGDPVFPPEGQK
PRWRAPDWYVQAVSGGMGPIGVLKGFEELYRMGWIDRIPKIAPIQAEGCAPMVHAWKQNR
ETAVPVQSPRTLIATLATGDPGRTYTYLRQKMLAASGGEFEAVSDDEAFRAMHFLAKMEG
LSVEPAAAVAFAGLVKLIRAGIIKPHETVVVNCSGHTVPVERNILGEGWARDLVPSQGME
ESNEEGLLAALTKVSLDRFPRILIVDDNPDVRRLIRRILQSQGEYKLYEATNGLEAIEMA
RRELPNLIILDLMMPEMDGFTVLNELKKSPETAEIPVIVVTAKELTPNEKDRLRGHIQTL
MQKGDFMSDEFMDEVRALLG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgccttctcatgttatcgttgaatgtcttgattgtggacacaaagcacctttctccatt
gtccagccagcctgtccgcagtgcggcagtatgtggcgtgaagcgcgttatgactatgac
gagttagccaccacactggctcaacgcctgtcttcccgcccctttgatatctggcgatac
cgcgaactgttaccggtggaaaaccctcgccctgagttgagcatgggcgaagggggcact
ccgctgattcgggctacaaatctgggaatgatgctgggaaatcccaacatctacgtcaaa
gacgaacgccaaggtccaacagcttcttttaaggatcggcaggcttctgtcacggttgcc
actcttaaggaagcgggagtctctgagtttgtcattgcctctaccggtaatgtggctatt
tcgtactctgcttactctgctcgggcaggaattaaattgtgggcatttctgaccagcctg
gttcccgccgccaaaatgcgcgaggtcgccatttacggcacacaggtcattaaaattaca
ggctcgtatgatcaagccaagaaagtggctgcggaatttgctcaacagcgccacctgagc
atcgacctgggggcacgcaccgtgccatgcatcgagtcaatgaaaacgattgcctttgaa
attgccgagcagttgaccaatctcatgggcgacccggtctttccacccgaaggacaaaaa
ccacgctggcgcgcccccgattggtacgtccaggcagtttccgggggcatggggcccatt
ggcgtgctcaaagggtttgaggaattgtaccgcatgggatggattgatcggattcccaaa
attgctcccattcaggcagaagggtgcgccccaatggtacatgcatggaaacaaaaccgc
gaaactgccgtgccggtccaatcccccagaacattgattgccactctggcaaccggcgat
ccgggtcgtacctatacctatctgcgccagaagatgcttgccgcttccgggggagagttt
gaggctgtctcagatgatgaagccttccgagccatgcacttccttgccaaaatggagggc
ctttcagtagaacctgcagccgcagttgcctttgccggattggtcaaactgattcgcgca
ggcatcatcaaaccccacgagaccgtagtggtcaattgcagtggacataccgttccagta
gaacgcaatatccttggagaaggatgggcgcgcgatttggtaccctctcagggaatggaa
gagagcaatgaggaaggcttgctggcggctttgaccaaagtctcgctggaccgcttccct
cgcattttgatcgtggatgacaatcccgacgtgcgccgtctcatccgccgtattttacaa
tctcaaggcgagtacaagttgtacgaagccaccaatggcctggaagccattgaaatggca
cgccgggaactgcctaacctgattatccttgacctgatgatgccggaaatggacggcttc
accgttctcaatgaactgaagaagtctccagagacagctgaaattcccgtcatcgttgtc
actgcaaaagaactgacccccaatgaaaaagaccggttgcgggggcacatccaaaccttg
atgcaaaaaggggatttcatgagcgacgaattcatggatgaggtacgtgcgttgttagga
tga

DBGET integrated database retrieval system