KEGG   Anaerolinea thermophila: ANT_13240Help
Entry
ANT_13240         CDS       T01410                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_13240 (pgk)
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     ANT_13240 (pgk)
Exosome [BR:atm04147]
 Exosomal proteins
  Proteins found in most exosomes
   ANT_13240 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1486285..1487460)
Genome map
AA seq 391 aa AA seqDB search
MFNKKSVRDIDVKGKKVLVRVDFNVPIKEGVVQDDTRIRAALPTIEYLLEQGAAVILFSH
LGRPKGGPDPKYSMKPVAEYLAQLMGKPVAFAEDCVGEPAEKAAANLKPGEVLVLENTRF
HPEEEKNDLELAKKMAALADIYVNDAFGSAHRAHSSTEGVARFLPAVAGFLMEKEIQYLS
QAIENPKRPFVAILGGAKVSDKIGVIKNLLTKADTILIGGGMANTFFKAQGYPVGKSLVE
DEVLDLARELIAQGGTKLRLPVDVVIAQSMEEGAETKVVPVGPIPDDWMILDIGPETVAS
YGKVIANAATVVWNGPMGVFEVSTFAKGTFGIADALAKSNAISIVGGGDSASAVQKSGLA
EKITHISTGGGASLEMLEGLFLPGVAALLDK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacaaaaaatctgttcgggatattgacgtcaaagggaagaaagtcctggttcgg
gtggattttaacgtccctatcaaagagggcgtggtgcaggatgatacccgtatccgggca
gcactgcccacaattgaatatttgctggaacagggcgccgcagtgattctcttctcccat
ctgggcagacccaaaggcggacctgatcccaaatactccatgaaaccggttgccgagtac
cttgctcaactgatgggtaagccggttgccttcgctgaggattgtgttggcgagcctgcg
gagaaagcagccgccaatctcaaacccggtgaagtgctggtgctggaaaacacccgcttc
catccggaagaagaaaagaatgacctggaactggcaaagaaaatggcagcgctggcagat
atctacgtcaacgatgcctttggaagcgctcatcgcgcccattcctcgacggaaggggtg
gcccgcttcctgcctgcggtggctggcttcctgatggagaaggaaatccaatatctctcc
caagccattgaaaatcccaaacgcccctttgtcgctattctgggcggtgcaaaagtgagt
gacaaaattggcgtgatcaagaacttgcttaccaaagccgataccatcctgatcggtggc
ggaatggcaaacactttcttcaaagcccaggggtatccggtgggtaagtcgctggtggaa
gacgaggttctcgatctggcacgtgaattaatcgcccagggcggtactaaactacgcctg
ccggtagacgtggtcattgcccaaagcatggaagaaggcgcagaaaccaaggttgtccct
gtgggtcccatccccgacgactggatgattctggacatcggacccgaaacggtggcgtca
tacggaaaggtgattgcgaacgccgcgactgtggtgtggaacggtccgatgggtgttttt
gaggtctcaacatttgccaaaggcactttcggcattgccgacgccctggcaaagagcaat
gccatttctatcgtgggtggaggcgactccgcctcggcagtgcagaaatctggactggca
gagaaaatcacccatatttcgacaggcggaggagcatcgctggagatgcttgaaggattg
ttcttgcccggtgtggcggccttactggacaagtaa

DBGET integrated database retrieval system