KEGG   Anaerolinea thermophila: ANT_13250Help
Entry
ANT_13250         CDS       T01410                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_13250 (gap)
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     ANT_13250 (gap)
Membrane trafficking [BR:atm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ANT_13250 (gap)
Exosome [BR:atm04147]
 Exosomal proteins
  Proteins found in most exosomes
   ANT_13250 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1487537..1488586)
Genome map
AA seq 349 aa AA seqDB search
MTVKVGINGFGRIGRQVLKAIMERYPNELEVVAVNDLFDAKTNAHLFKYDSNYGIFNGTV
EVSGTDLVINGKTVKVLAEKDPAKLPWKDLGVDIVIESTGVFTDALGDPAKGKAGANAHL
QAGAKKVIISAPAKNEDITIVMGVNDDKYDPAKHHIVSNASCTTNCLAPAAKVVHEKFKI
LNAVMVTIHSYTNDQVILDQGHKKEMRRSRAAGLNIIPTTTGAAKAVALVIPDLKGKFDG
YALRVPTPTVSIVDFTATVEKATTKEELNAAFMEAANGALKGILGVTTGEYMDPLVSMDF
KGDSRSSIVDLPSNMVMGGNLIKVVTWYDNEWGYSCRTADLAAMMAKKL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcaaagttggtattaatgggtttggacgcatcggtcgtcaggtattgaaagcc
attatggaacgatacccgaacgaactggaagttgtggctgtcaatgacttgtttgacgcc
aaaaccaatgcccacctgttcaaatatgattccaattacggcattttcaacggcaccgtt
gaagtttccgggaccgaccttgtgatcaacggcaaaaccgttaaggtgttagccgaaaaa
gatcctgccaaactgccgtggaaggatctgggcgtggatattgtgattgaatccaccggc
gtgtttaccgatgcactgggcgatcctgcaaaaggaaaagccggcgccaacgctcacctg
caggctggtgccaagaaagtcatcatttctgccccagcgaaaaatgaagacatcaccatc
gtcatgggtgtgaatgacgacaagtatgaccccgccaaacaccatatcgtctccaacgcc
tcctgcaccacgaactgtctggcacccgctgcgaaagtggtgcatgagaaattcaagatt
ttgaacgccgtgatggtcaccattcactcctacaccaacgaccaggtcattctggatcag
ggtcacaagaaagaaatgcgccgctcccgcgccgctggcttgaacatcatccccaccact
accggcgccgccaaagccgttgcgttggtgatccccgacctgaagggcaaattcgatggt
tatgctctgcgcgtgcccacgcccacggtgtcgattgttgacttcactgccactgtggaa
aaagccactaccaaagaagaactgaatgctgccttcatggaagccgccaatggcgctttg
aagggtatcctgggggtgaccaccggcgaatacatggatccgctggtgtccatggacttc
aaaggtgactcccgctcctcgattgtagacctgccctccaatatggtgatgggcggcaac
ctgatcaaagtcgttacctggtacgataacgaatgggggtattcctgccgcaccgccgat
ctggcagccatgatggcaaagaaactgtaa

DBGET integrated database retrieval system