KEGG   Anaerolinea thermophila: ANT_13270Help
Entry
ANT_13270         CDS       T01410                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANT_13270 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_13270 (glk)
   00052 Galactose metabolism
    ANT_13270 (glk)
   00500 Starch and sucrose metabolism
    ANT_13270 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ANT_13270 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ANT_13270 (glk)
   00524 Butirosin and neomycin biosynthesis
    ANT_13270 (glk)
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ANT_13270 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1490141..1491073
Genome map
AA seq 310 aa AA seqDB search
MDYYIAVDIGGTQLRAALYPEGEQKAVSQKRIPTQTKDQSPVDRLLELIKNIMPSQGKVK
AIGMAAPGPINPKTGILYAAPNIPGWVNLPLAQIVQDRFKVPTLLGNDANLAAMGEWKFG
AGRGYQHLLYMTVSTGIGGGVIEEGKLLLGYKGLAAEIGHITVDPNGPLCGCGQRGHLEA
LASGTAIARYVSEQLASGVPSSMAELPAVTARDVSLAAEQGDPLAREALARAGRYLGRAI
ADFLHLFNPQIVIIGGGVSRSGRYFLDPLRNSIAEYVISPEYLHGLVVTTASLGDDAGLL
GALALAQTVE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggactattacatcgctgtagatattgggggaacccagttacgagccgcactgtacccg
gagggagaacagaaagctgtatctcagaagcgtatccccacacagaccaaagatcagtct
cccgtagatcgtctgctggaactgattaagaatattatgccctcgcagggtaaagtcaaa
gccattggtatggcagcaccgggccccattaatcccaagactggaattttgtatgccgct
ccgaacatccccgggtgggtgaatcttcccctggcgcagattgttcaggatcgtttcaag
gtccccacgcttttaggaaatgatgctaaccttgccgccatgggggagtggaaatttggt
gcggggcgtgggtatcagcatttgctctacatgactgtcagcacaggcatcggcggtggt
gtgattgaggaaggaaaattgctgttaggttataaaggattagcggcggaaatcgggcat
atcacggtggaccctaatggcccactgtgtggttgtggacagcgaggacatctggaagcg
ctggcttcaggtacggcaattgcgcgttatgtttccgagcaactcgctagtggggtgcct
tcatccatggctgaactgcccgctgtgacggcgcgcgatgttagcctggcggcagaacag
ggagacccattggcgcgggaagcgcttgcccgcgcagggcgttatttgggtcgagccatt
gcagatttcctgcatttattcaatccccaaattgtgattatcgggggtggggtctctcgt
agtgggcgttatttcctcgatcccttgcggaactcaattgcggaatatgtgatttcccca
gagtatttgcatggattggtggtaaccacggcctctcttggggatgatgcgggactgctg
ggtgccctggcgctagcacaaactgtggagtaa

DBGET integrated database retrieval system