KEGG   Anaerolinea thermophila: ANT_13280Help
Entry
ANT_13280         CDS       T01410                                 

Definition
(GenBank) putative 4-aminobutyrate aminotransferase
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAJ63360
NITE: ANT_13280
UniProt: E8N4J6
Position
1491233..1491691
Genome map
AA seq 152 aa AA seqDB search
MVTRLKLPGVIAQSLIERDHRVISPSYPRGYPFVMDHGKGCEVWDVDGNRFLDFAAGIAV
NSTGHSHPKVVKAIQEQAEKFLHISSDFYHEGWIRLGESLNDIAPFNEPAVSFMTNSGTE
SVEAAIKLARYVTGRTQFIGFLGDFTDERWGL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggttaccaggctgaaactgcccggcgttattgcacaatccctgattgaacgcgatcat
cgtgtgatatcaccttcctatccgcgtggttatcccttcgtcatggatcacggaaaaggt
tgtgaagtatgggacgtggacggcaatcgtttcctggattttgccgcaggcattgcagtg
aactcgaccgggcatagtcatcccaaagtggtcaaagccattcaggagcaagccgaaaag
tttttgcacatctcatcagatttttaccatgagggatggatcagattgggagaatccctg
aatgatattgcgcctttcaatgaaccggctgtttctttcatgaccaattcaggtaccgaa
agtgtggaggcggcgattaaactcgcccgctatgtcaccgggcgcacccagtttattggc
tttctgggggatttcacggacgaacgatgggggctgtga

DBGET integrated database retrieval system