KEGG   Anaerolinea thermophila: ANT_13300Help
Entry
ANT_13300         CDS       T01410                                 

Definition
(GenBank) putative two-component sensor histidine kinase
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1492548..1494113
Genome map
AA seq 521 aa AA seqDB search
MLEPLLPDFRVRQRDYLLEIARALTQELDLKKLLGRILRIAIEMLAGQAGLIALREEEGG
WRVVVTQGIPMAFLRAIENVLANVPADEDPERYELPEINRQVNELAQAASMGLLHGIVLP
LITLQRVVGLIVIFRSYAGSFTSNDIALLSSFADQAAIAVQNAQLYTQTNLEKERLNALL
DSLADGILILRPDHSIERCNPAISRMLNLPLENIRGRRHDEIIRWSKPPQGITLEQAESD
GWPLTPHAYLYVEGDLSRSGLAPLPVGITYAPLISSENKLVNIIATVRDITRFRQAEELK
STFISIVSHELKTPVALIKGYVSTLRREDASWDPEIIQDSLKVIEEEADRLAVMIENLLD
ASRLQAGGLTLKKSDLSLPELARRVAQRMQTQTSSHRIVVDFPDDFPIVLADEGRLQQVL
TNLIGNAIKYAPGGEIRVHGEARGNQIIVCVSDQGPGINPEDVPHVFDRFYRNPEAAKKT
KGAGLGLYLSRAIIEAHGGRIWVDSHPGQQGARICFTLPRD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaccgctcttacccgattttcgagtccgtcaacgtgattacctgctggaaatt
gcccgagcgttaacccaggaactggatttaaagaaacttctgggtcgtattcttcgtata
gccattgaaatgctggcgggacaggcagggttgattgcgctccgggaggaagaaggtggc
tggcgcgtggtggttactcaagggatccccatggctttcttgcgagcaattgagaatgta
ctggcaaatgtccctgccgatgaggatcccgaacgatacgaacttccggaaattaatcgt
caggtaaatgaattagcacaagccgcaagtatggggttgttgcatggcattgtcctgcct
ctcattacacttcagcgtgtggtggggttgattgtcatcttccgttcgtatgccggcagt
tttacctccaatgatattgccttgttgagcagtttcgccgaccaggcagccattgcggtg
caaaatgctcagttgtacacacaaacgaatctggagaaagaaaggcttaatgctttactg
gactccctggcagacggaatcctgattctccgtccggatcattccattgagcgctgtaac
ccggcaatttccaggatgttgaatttgccattagaaaatattcgcggcagacgtcatgat
gaaatcatccgctggagcaaacccccacagggaatcactctcgaacaagccgaatcagat
ggctggcctcttactccgcatgcatacctttacgttgaaggggatctttcccgctctggt
ttagcccccttgccggttgggattacctatgcgcctttgatctcttccgaaaataaactg
gtcaatattattgccacggtgagagacattactcgtttccgtcaggcggaagagttaaaa
tctacttttatctccattgtaagtcatgaacttaagacccccgtggcactgattaagggc
tatgtaagtactttgcgtagagaagacgcttcctgggacccggaaatcattcaggacagc
ctgaaggtgatcgaggaagaagccgaccgcttagcggtgatgattgagaacctgctggat
gcttcacgcttgcaagccggtggtttaactctgaagaagagcgatttgtctcttccagaa
ttggctcggcgagtagctcagcggatgcaaactcagacttcctctcaccgcattgtggtg
gattttccagacgattttcctattgtgcttgccgatgaaggcagactacaacaggtgctg
accaatttgataggcaatgcgatcaagtacgctcctggtggagagatccgtgtgcatgga
gaggcacgtggaaatcagattatcgtttgtgtgagtgaccagggccctggtatcaaccct
gaggatgtccctcatgtgtttgatcgcttttaccgtaaccctgaagcagcaaaaaagacg
aaaggtgcggggttgggtttgtatttgtcacgggctatcattgaggcgcatggaggaagg
atttgggtagatagtcaccccggtcaacagggtgctcgaatttgtttcaccttgccccga
gattag

DBGET integrated database retrieval system