KEGG   Anaerolinea thermophila: ANT_13340Help
Entry
ANT_13340         CDS       T01410                                 

Definition
glycosidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
atm  Anaerolinea thermophila
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ANT_13340
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ANT_13340
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ANT_13340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1497370..1500198)
Genome map
AA seq 942 aa AA seqDB search
MVFFMKRSLPLIRVFLLVAVLLSAVFPVASANSLPQADEARQKARSLLNKLTPEERIGQL
FLVTFQGTNTASDTPIYTLITKYHIGGVVLQRKNNNFNDQESLLLSTFNLIHALQEIEWQ
QSQSEEQSYQYIPLFVGISQEGDLAPNDQILSSLTPLPNLMAIGATWDTGMAQRVGTVLG
SELSALGFNLILGPSLDVLDVSYTVGKEDLGSRTFGGDPYWVSEMGKAYIAGIHQGSGNK
IAVIAKHFPGRGSSDRQPEEEIATVRKTFEQLKQVELAPFIAVTSTPFPADTTTDGLLLS
HIRYQGFQKNIRATTNPLSFDRTALNEILSLPEFSRWRENGGVIISDNLGSPAIQRFFDP
SGTNFDARQVTRNAFLAGNDILYLDSLISTGDTDSFTTLTRILESFTQKYNEDPTFAQRV
DDSVERILTLKFRLYPDFNFEEIAPSEANLGAVGKSQKVTFDVAARAATLISPDFTELIS
VLPSPPQPRDRLVFFTDAILSRQCTTCAEKSIPAINALQNTVLQLYGPQAGAQVSSNRLS
SYSFLELWQALQNQEGTETLVREIQLADWVIFSILNETNTRPESNALRQLLSERPDWIRN
KKIIVFAFNAPYYLDATDISKLSAYYALYGKTSPFIDIAARLLFQEMIPSGASPVSIPGI
GYDLIEAMTPDPNQIISLQLDIPEGMVKPGGTPEATPIPTFKIGDVIPLKTGVILDHNRH
PVPDGTPVRFYFSLGGESGMSQVVETVTQNGIARASYRIERGGLLEIRVASEPAINSNIL
RLDITSTEGAVVTAILPTPIPTETPIPTTTSTPEATPTSNPEPVQSRPAPTLSLWLLSTL
LSLGGAFTGGWLGMHFLPSPRWAVRLGLTVLMGGVLAYLYLALGLPGSKEVLIQTWKGIL
WVTGIGMLIGGLVGYSWHEVNQHFINFKDISKTPRKPDEHST
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggttttcttcatgaagagaagtcttcccctcatccgtgtttttcttcttgtggctgtg
cttttatcagccgtgtttcctgttgcctcggcaaattctctccctcaagccgacgaggct
cgccaaaaagcgcgcagtttattgaacaaacttacccctgaagaacgcattggccaatta
ttcctggttacttttcaagggacaaacactgcttccgacactcccatttacaccttaatc
acaaaataccacattggaggcgtagtattacaacggaaaaacaacaattttaacgaccag
gaaagtttactgctgagcacgtttaacttgattcacgcgcttcaagaaatagaatggcaa
cagtcccaaagtgaagagcagagctaccaatacatccccctgtttgtaggcatctctcaa
gaaggtgaccttgctccaaacgatcagattctttccagcctgacgccgcttcccaatctg
atggcaatcggggcaacctgggatacaggtatggcacagcgggtcggcacggtgctggga
agtgagctcagcgccctgggttttaatctaatccttggaccgtctttagatgttctggat
gtgtcttatacggttgggaaggaagaccttggctctcgtacctttgggggagatccttac
tgggtcagcgaaatgggaaaagcctacatcgccggaattcatcagggcagtggcaacaaa
attgcagtgattgccaagcactttcccggtcgaggaagttcggatcgccaaccggaagaa
gaaattgctactgtgcgaaagacctttgagcagttgaaacaggttgaactggcgcctttc
attgcagtgaccagcaccccgtttcctgcagacaccacgacagatggtttgcttctttcc
cacattcgctatcaaggtttccagaaaaatattcgcgcgaccacaaacccgttaagtttt
gatagaaccgccctgaatgaaattttgagcctgcccgagttttcacgatggcgtgagaat
ggtggcgttatcatcagtgataatctgggaagtccagctattcagcgctttttcgacccc
agtggtacaaattttgatgcccgtcaggttacccgcaatgcttttctggcagggaatgat
attttatatcttgattccctgatatcaacaggggataccgactctttcaccacccttacc
cgaattttagagtccttcactcaaaagtataatgaagaccccacttttgcccaacgggtg
gatgactcagtcgaacgcattcttacgttgaagtttcgcctgtatccagacttcaatttt
gaagaaatagcgccctctgaagccaaccttggagccgtcggtaaatctcaaaaagtgaca
ttcgatgtggccgcgcgtgctgcgacattgatcagtccagattttacagaattgatcagt
gtcctgccatccccccctcaacccagagatcgcctggtgttctttacggacgctatcctt
tcaaggcaatgcaccacctgcgcagaaaaatccattcctgcaattaatgccttgcaaaat
acagtattgcaactgtatggtcctcaagcaggtgcacaggtatcgtcgaatcgcctcagt
tcatactctttcctggaactctggcaagccctgcagaatcaggaaggaacagagactttg
gttcgtgaaattcaactggcagattgggtaatcttctccatccttaacgaaactaacacc
cgcccggaatcgaacgctttacggcaattgctctctgaaagacccgattggattcgaaac
aaaaaaatcattgtatttgccttcaacgctccgtactatctggacgctacggatatcagc
aaactcagtgcctattatgcactttatggcaaaacatctccttttattgatattgccgct
cgtctgctctttcaggaaatgattccttcgggagcctctcctgtttccattcccggcatt
ggctatgatctgattgaagctatgacccccgatcccaatcaaatcatcagtctccaactg
gatatcccagaaggaatggtaaaaccgggaggaactccggaagcaactcccattccaacg
ttcaaaattggggatgttattcccctgaaaacaggggttattctggaccataatcgacat
cctgtccccgatggtacacctgtgcgtttctacttctctctggggggagaatcagggatg
tctcaagtggtcgaaacggtcactcagaatggaattgctcgggcttcttaccggattgaa
cggggagggttgctggaaatccgcgtggccagcgagccagccataaattcaaacattctg
cgattggatataaccagtacagagggggctgtggtcacagcaattttacctacccccata
cctacagaaacacctatcccaacaaccacttcaaccccggaggcaacccccaccagcaat
cctgagccggtgcaatctcgccctgctcccacgctctctttatggcttctatccactctc
ctttcccttggaggagcgttcacgggcggttggctgggaatgcattttcttcctagcccg
cgttgggcagtgagattaggattaaccgttcttatggggggagtcctggcttatctctac
ctcgctctgggtttgcccggcagcaaagaggtacttattcaaacctggaaaggcatcttg
tgggtaacgggaataggaatgttgattggcggtttggtggggtacagttggcacgaagtt
aatcagcactttatcaatttcaaagatatatcaaaaactcccaggaaacctgatgagcat
tcaacgtaa

DBGET integrated database retrieval system