KEGG   Anaerolinea thermophila: ANT_13490Help
Entry
ANT_13490         CDS       T01410                                 

Definition
(GenBank) major facilitator superfamily transporter
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_2 MFS_1_like MFS_3 TRI12 MFS_4 OATP
Motif
Other DBs
NCBI-ProteinID: BAJ63381
NITE: ANT_13490
UniProt: E8N4L7
Position
complement(1513782..1515011)
Genome map
AA seq 409 aa AA seqDB search
MTKNKPLSSIFLVVFIDLLGFSLILPLLPYLAKSFSASEFQIGLLVASYALAQFIGAPFL
GRLSDRFGRRPILLISIAGNAIGFFLLGIAQNLEMLFLSRILAGFTAANISVAQAYISDV
TDAQSRARGLGLIGAAFGLGFILGPAIGGALSQFGYAYPAFAATGLSALNFLLVFSWLKE
SLTPERRQALNHQQRPPITLKAMLETLRRPYVGPLLHTRFFFGLAFSLFQTIFSLYALER
FNLQARDTGYILAYVGVISVLTQGVFIGKLTRKFNEIQLMFVAILTMAFSLLAWGFAPSV
PVLLITLLPIAMSGGILNTVINSALSKSVAPIETGGILGLSASLESLTRVIAPSLGTLLL
QITSQSYGVFIGTAVPGLAAFVLLIWLGSYFWRMIYRVPPVVHSPSGMD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaacaaaccactttcttccatttttctggttgtttttattgatttattgggt
tttagtttgattctcccgctcttgccttatctggcaaagagtttttctgccagtgagttt
caaatcggtttgctggtggcttcctatgcactggcgcagtttattggcgcacccttttta
ggaagactttcagaccgttttggaagacgccccatcctgctgatttccatcgccggaaat
gccatcggtttcttccttttaggaattgctcaaaaccttgaaatgctcttcctttcccga
attctggcagggtttacagcggcaaacatcagtgttgctcaggcttacattagcgacgtg
accgatgctcagagccgcgctcgaggattagggctaattggcgccgcattcggtttaggc
ttcatccttggtccggcaattgggggagcgcttagccaattcggttatgcgtacccggct
tttgccgcaaccggtctttcagcgcttaatttccttctcgttttttcatggctgaaggaa
tccttaactccagaacgccgccaagccttgaaccatcaacagcgtcctcccatcaccctg
aaagccatgctggaaactttgcgccgtccctacgtgggacccctgctccacactcgtttc
ttctttggattggcattctctctctttcaaaccattttctctctttacgcgttagagcgc
tttaacctccaagcccgggataccggttatatccttgcctatgttggcgttatctccgta
ctcacccagggagtctttattggaaagttaacccggaaattcaacgaaattcaattgatg
tttgtagcaatcctgaccatggcattttccctcctggcatggggatttgccccttcagta
cctgtacttcttatcacactgttaccaattgccatgtcaggcgggattttgaataccgtc
atcaacagtgcactatccaaatcagtagcccccattgaaacgggtggaattttaggactt
tcggcttctctggaatctcttacccgggtaattgccccttcactgggcacattactgctt
caaatcacctcccaaagttatggggtatttattgggactgctgtcccgggcttggctgcc
tttgtattacttatctggttgggctcttatttctggcggatgatctatcgtgttccgcct
gtggtacatagcccaagcggcatggattag

DBGET integrated database retrieval system