KEGG   Anaerolinea thermophila: ANT_13540Help
Entry
ANT_13540         CDS       T01410                                 

Definition
(GenBank) putative transposase for insertion sequence element
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS66 DDE_Tnp_ISL3 DnaJ_CXXCXGXG Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: BAJ63385
NITE: ANT_13540
UniProt: E8MY63
Position
complement(1518764..1519792)
Genome map
AA seq 342 aa AA seqDB search
MKIILQLPQVKRKKPARPKRCPYCQGETFQRWGVEKRRIEDVKVRHVEVVRYRCTRCRRT
FRDYPEGVGNGRHSERLKKLSVILWSLGLSYRRVAGVLRIFGLRLSHMSGWRHVQAEGEK
LMGELKWKSVRVVGVDGAWVGGKGVMVAVDLGDGSLLEVAEVDEKDSRALFTWLKRLKEM
HDIGAIVSDDLAIYKQLTDELEIGHQVCQFHVRRWVKHALKGLQAELDPAWQGVLEKVEE
ILRDLPLHGDRLLHRLWKSLPGRSTPPEGKRTPLEKLRDLILRLSRDWQRYVAFYADVGI
PWTNNRTEQMIGRLKSRAQQARRYKTTAGLLRGSTVACQFWA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagattatactccaactgccacaggtaaaacgaaaaaagcctgctcgtccgaagcgc
tgtccatattgtcagggggagacattccagcgatggggagtggagaaaaggcgcatcgag
gatgtcaaagttcgtcatgtcgaggtggtgaggtatcgatgcacacggtgcaggcgcacc
tttcgggactatccggagggggtaggcaatggacggcacagtgaacggttgaagaaattg
agtgtgatcctgtggtcactgggattgagttatcgcagggtagccggggtgttgaggatc
tttgggctgaggctcagtcatatgagcgggtggcggcatgtacaggcagagggggaaaag
ttgatgggggaattgaaatggaaaagcgtgcgggtggtgggggtagatggagcctgggtg
ggaggcaaaggagtgatggtggcggtggatctgggagatggtagtctgctggaggttgcc
gaggtagacgagaaagacagccgggctctgttcacctggctgaaacggttgaaagagatg
catgacatcggcgccatcgtgagcgatgatctggcgatctacaagcaactgaccgatgaa
ctggagatagggcatcaggtctgtcagtttcatgtgcggcgctgggtaaagcatgctttg
aaggggttacaggctgagttggatccagcctggcagggggtgcttgaaaaggtcgaggaa
atcctgcgcgacctgccattgcatggagaccgcctcttacaccgcctgtggaaatccctg
ccgggcaggagtacaccaccggaaggaaaacgcacgcccctggaaaaactccgcgacctg
atcctgcgcttatcgcgtgattggcaacgctatgtggctttctatgctgatgtgggtatt
ccctggaccaataatcgcacggaacagatgattggcaggctcaagagccgcgcccagcaa
gccaggcgatataaaaccaccgccgggttgctccgcggaagcacagttgcctgtcagttc
tgggcatga

DBGET integrated database retrieval system