KEGG   Anaerolinea thermophila: ANT_13660Help
Entry
ANT_13660         CDS       T01410                                 

Definition
(GenBank) L-ribulose-5-phosphate 4-epimerase
  KO
K03077  
L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
atm  Anaerolinea thermophila
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ANT_13660
   00053 Ascorbate and aldarate metabolism
    ANT_13660
Enzymes [BR:atm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     ANT_13660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1531392..1532039)
Genome map
AA seq 215 aa AA seqDB search
MLLPNLREELLYLHLQLPKNGLVTWTSGNVSVRDVSTGWVLIKPSGVFYENLHPEDFILL
DLDGNVLEGSLKPSSDTASHLYIYRHRPDVNGIVHTHSPYATAFAAVGKAIPVYLTAQAD
EFGGAIPCAGLGLIGGEEIGKLVVETIGTSPGCLLQNHGVFTIGKDGSSAVKAAVMIEDI
AKTVWLAMQLGTPIPIPEDMVQRLHQRYTRDYGQG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttgctacccaatctccgcgaagaactactttacctgcatttacaattacccaagaac
ggcttggttacatggacaagcggaaatgtaagcgtgcgagatgtatccacgggatgggtg
ctgatcaagccttcaggggttttttatgaaaatcttcatccggaagatttcattcttctc
gatcttgacgggaacgttctggaaggatccctgaaaccttcttcggatacagcaagccat
ctttatatttaccggcatcgcccggacgtaaatggcatcgtacatactcactccccttat
gcaacggcttttgcagccgtaggcaaagccatcccggtatatctcacagcacaagcggat
gagtttggaggagccattccatgcgcgggtttaggtttgattggcggagaagagattgga
aaactggttgtagagaccattggaacatcccccggatgtcttctccagaatcatggcgtt
tttaccattgggaaagatggaagttctgcagttaaagccgctgtgatgattgaggatatt
gccaaaacggtttggctggcaatgcagttgggaactccaatccctataccggaagacatg
gttcagagactccatcaacgctatacccgggattatgggcaagggtga

DBGET integrated database retrieval system