KEGG   Anaerolinea thermophila: ANT_13690Help
Entry
ANT_13690         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1534887..1536323)
Genome map
AA seq 478 aa AA seqDB search
MHMKPVTLGVIVGNRGFFPDHLCITGRKTILKVLEEEGIHPIIIDENETKVGSIVTLNDA
QKCAELFKAHRDEIDGILVTLPNFGEEKAIANTLRWAGLNVPVLIHAFPDDMTRMTVADR
RDSFCGKMSVCNNLTQYGIPFSLTSLHTVNPESESFRADLRRFAAVCRVVRGLRNARFGA
IGARPAAFNTVRYSEKLLERTGISVETIDLSEIFGRAARLHADDPKVKAKIEQIQSYVPT
KNTPGEALIRMAKLGVVIEDWMAENQLVASALQCWTSMEEFYGVVPCTLMSMMSNSLVPS
ACETDIAGAVGMLALALASGKPSAIVDWNNNYGDDPDKGVIFHCSNLPKDLFLEAAASQE
DAPQMDYQAIIAGSVGKENTYGTVVGRLKAVPFTYCRVSTDDLHGRILAYVGEGHLTEDT
LKTFGGYGVVHVPNFQKLLAYICENGFEHHVAINPSMVADAVNEAFTKYLGWQVYYHH
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgaaacccgtgacgttaggtgtaattgttggcaatcgaggattcttccccgac
catctctgtatcactggacgcaaaaccatccttaaggttcttgaagaggaaggaattcat
ccaatcatcattgatgaaaacgagaccaaggtgggatcaattgtcaccttgaacgatgca
cagaaatgtgccgaacttttcaaagcccatcgagatgaaattgatggcattctggtcact
ttacctaattttggcgaagaaaaagccattgccaataccctgcgttgggcaggattgaat
gtgcctgtgctgattcacgcctttccggacgacatgactcgtatgacggttgcagaccgc
agagactcgttttgtggaaaaatgtcggtgtgcaacaaccttacccaatacggtattcct
ttcagtctaaccagccttcacacagttaatccggaaagcgaaagtttccgggctgacctg
cgtcgttttgccgccgtctgccgggtagtccgaggattgcgcaatgcacggtttggggca
attggcgccagacccgccgccttcaatacggtccggtacagcgaaaaattgctggaacgc
acaggaatcagtgtagaaaccattgacctctcagaaatatttggacgtgcggcgcgttta
catgctgacgatcccaaagtgaaagccaaaattgagcaaattcaatcctatgtcccaaca
aagaatacccctggcgaagccttaatacgcatggcaaaactcggggtcgtgattgaagat
tggatggcagagaatcaactggttgcctcagcgttacaatgctggacatccatggaagaa
ttctacggtgtagtgccatgcacgttgatgtctatgatgagcaactccctcgtaccatcg
gcttgcgaaacggatattgccggtgctgtaggcatgctggcactggcattagcctcggga
aaaccctcggcaattgtagattggaataacaactacggcgatgaccccgataaaggtgtc
atcttccactgctccaacctgcccaaggatttgttcctggaagccgcggcttcacaggaa
gacgctcctcaaatggactatcaagccattatcgccggctcggtaggaaaagagaacacc
tatggaacagtcgttggacgcttgaaagccgtgccttttacctattgccgggtatccaca
gatgaccttcacgggcgcattcttgcctatgtaggcgaaggacatttaacagaggatacc
ctgaaaacctttggaggatacggcgttgtccacgtgccaaatttccagaaattgctggct
tacatttgtgagaatggtttcgagcatcatgttgccatcaatccatccatggttgcagac
gcagtcaacgaagccttcaccaagtatttgggatggcaggtttactatcaccactaa

DBGET integrated database retrieval system