KEGG   Anaerolinea thermophila: ANT_13710Help
Entry
ANT_13710         CDS       T01410                                 

Definition
(GenBank) fumarylacetoacetate hydrolase family protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase DUF2437
Motif
Other DBs
NCBI-ProteinID: BAJ63399
NITE: ANT_13710
UniProt: E8N4N5
Position
1537739..1538500
Genome map
AA seq 253 aa AA seqDB search
MKFLQFSLSGESPRTGWLYQDRIGVVEGSIFGEYRRMEAVFPLDRVRLMAPLHPGKIIAV
GRNYVEHARERGAEVPEVPLIFLKPPSSVVGPGDPILLPPQSQRVDHEAELAVVIGKRGR
WIAPEQAMDFVFGYTCANDVTARDLQQKDGQWTRAKGFDTFCPLGPWIETELDPFDVLIQ
CKVNGEVRQVGSTKEMVFSIPQLIAYISSVMTLEPGDIILTGTPAGISPLKAGDLVEIDI
EGIGTLSNPVKEP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcttcaattttctcttagtggcgaatccccccgtacgggatggctgtaccag
gatcggattggcgttgtagaaggttccatctttggcgagtatcggcggatggaagccgta
tttcctttggatagagttcgcttgatggcgcctcttcacccgggaaaaatcattgcagtg
ggaagaaattatgtggagcatgccagagaacgcggtgccgaggttccagaagttccgttg
attttcttgaaacctcccagcagtgtcgtgggaccaggagaccccatcttgctgcctcca
caatctcagcgtgtagatcatgaggctgaactggcggtagtcattgggaaaagaggacgc
tggattgctccggaacaagccatggattttgtctttggatatacctgcgcaaatgacgtt
actgcgcgagatttacaacaaaaggatggacaatggacacgggcgaagggcttcgacacc
ttttgtcccctgggaccgtggattgaaacggagttggacccctttgatgttctgattcag
tgtaaggttaatggagaagttcgtcaggtagggtctacgaaggaaatggtgttctccatc
ccgcagttaattgcctatatttcttcggtaatgacacttgaacccggcgatataattttg
actggtactccggcgggaatctcgcctctcaaagcgggggatttggtagaaattgacatt
gaagggattggaacgctgtccaatcccgtaaaagaaccttag

DBGET integrated database retrieval system