KEGG   Anaerolinea thermophila: ANT_13730Help
Entry
ANT_13730         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg DUF3539
Motif
Other DBs
NCBI-ProteinID: BAJ63401
NITE: ANT_13730
UniProt: E8N4N7
Position
1539409..1540167
Genome map
AA seq 252 aa AA seqDB search
MSGHSKWATIKRKKGAMDAKRGQLFTRLTREIVMAAREGGGDPETNFRLRLAVEKARSQN
MPKENIERAIKRGTGESKEGNAFEQVFYEGYAPHGVALMIECYTENRNRTVAEIRHLLSR
AGGNLGEAGSVSWQFKRMAYFALSASKVDFDRVFEVAVENGAEDVTQDGDTIEVFAPVEN
FKVLSDAFRNAKMELEEAELRMIPTNEVELGVEETLQVLRTIDTIEELDDVQNVYHTMKI
SEAALAALENEA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtctggccattcaaaatgggcaacgattaagagaaaaaagggtgcaatggatgcgaag
cgggggcagttgtttacccgactgactcgcgaaattgtcatggcggctcgagagggtggt
ggcgatccagaaaccaatttccgtttacgcctcgcagtggaaaaagcccgttcccaaaac
atgccaaaagagaatatcgaacgcgcgattaagcgtgggacgggagagtctaaagaggga
aatgcattcgagcaggttttttatgaagggtacgctcctcatggtgtggctttaatgatt
gagtgctataccgaaaaccgtaatcgcacggttgccgagattcgccatttgctcagccgt
gcgggtggtaatttgggtgaagcgggttctgtgtcctggcagttcaagcgcatggcttat
ttcgcactttctgcttccaaagtggattttgaccgtgtgtttgaagtggctgtagaaaat
ggtgcggaagatgtgacgcaggatggcgacactatcgaagtgtttgctcccgtggaaaac
ttcaaagttctcagtgatgcgttccgcaacgcgaagatggaactggaagaagccgaactt
cgtatgatccccaccaatgaagtggaactgggagtggaggaaacccttcaggttcttcgc
acgattgatacgattgaagaacttgatgacgtgcagaacgtttatcatacgatgaaaatt
tcggaagccgcccttgcggcgttggagaacgaagcctga

DBGET integrated database retrieval system