KEGG   Anaerolinea thermophila: ANT_13780Help
Entry
ANT_13780         CDS       T01410                                 

Gene name
atpG
Definition
(GenBank) ATP synthase gamma chain
  KO
K02115  
F-type H+-transporting ATPase subunit gamma
Organism
atm  Anaerolinea thermophila
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    ANT_13780 (atpG)
Photosynthesis proteins [BR:atm00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   ANT_13780 (atpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1543838..1544740
Genome map
AA seq 300 aa AA seqDB search
MASTREMRLRIRSVKNLSQVTKALETVSASRVRKAIQANNSSKPYAEKAWKVLVHLARQP
GHDALHPLLADRPVVRRALVILVTSDRGLAGSYNANIFRHTLHEFSQKPYPVDFVAVGRK
GRDLLLRRRKNVIAEFSDLPSPPLYREVAPIASLAIEDFEKQKYDEVYICYTQFINMMRY
EPVTRRLLPLKILYKDEAPDIHTLDATHRTHSVFSFEPDEGEVLSNIVPHFTGIQIFQAI
LSAQASEHAARMIAMRNATESAQELIQSLQLEYNKLRQTLITNEMLDIAGGANALAQEKE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctacgcgagaaatgagactgcgtatccgcagtgtcaagaatctttctcaagtc
accaaggctctggaaacggtcagtgccagccgggtacgcaaagcgatccaggcaaataat
tccagcaaaccctacgccgaaaaagcctggaaagttcttgtgcatctggcgagacaaccc
gggcatgatgcgcttcatccgttgctggcagaccgtcctgtagttaggcgcgcgctggtt
attctggtgaccagtgatcgagggttggctggctcttacaatgccaatatttttcgtcat
accctgcatgaattcagtcagaagccttacccggtagattttgtggctgtaggcagaaag
ggaagggatttacttctgcgacgcagaaaaaatgtaattgcagagttcagcgatttacct
tctccgcctttgtacagagaagtagctcctattgccagtttggcgattgaggacttcgag
aaacaaaagtatgatgaggtgtatatctgctatacccagtttatcaatatgatgcggtat
gagccggtaacccgcaggttgcttcccttgaaaatcctctataaagatgaagcccccgat
atccatacgctggatgcaactcatcgcactcattcggttttctcttttgaaccggacgaa
ggggaagttctgagtaatattgtgcctcactttaccgggattcaaatttttcaggcgatt
ttgtcggcacaagccagtgagcatgcggcgcgcatgattgccatgcgtaacgctacggag
agcgcgcaggaattgattcaatcgcttcaacttgaatataacaaattgcgtcaaacactc
attacaaacgaaatgctggatattgctggtggggcaaacgccctggcacaggaaaaagaa
taa

DBGET integrated database retrieval system