KEGG   Anaerolinea thermophila: ANT_13800Help
Entry
ANT_13800         CDS       T01410                                 

Gene name
atpC
Definition
(GenBank) ATP synthase epsilon chain
  KO
K02114  
F-type H+-transporting ATPase subunit epsilon
Organism
atm  Anaerolinea thermophila
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    ANT_13800 (atpC)
Photosynthesis proteins [BR:atm00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   ANT_13800 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1546166..1546582
Genome map
AA seq 138 aa AA seqDB search
MPIRCEIVSQDRVVFAEDVDMVILPGGGGQMGVLPNHSPVLTTLQYGIIHVKKQGEEYYF
TVAGGFAEVQPDQVTVLADAAENVEEINLQRAEEARRRAENLLKQGIPEDTDEYLNIQAA
LRRSNLRIEAVKRYRRHH
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgccaatccgctgtgaaattgtttcgcaggatcgggttgtctttgcagaagacgtggat
atggtgattcttccgggagggggtggacaaatgggggtgttaccgaaccactctcccgta
ctaaccaccttgcaatatggcatcatccatgtgaaaaagcaaggggaagagtattatttt
actgtggcggggggctttgccgaggtacagcctgatcaggtaaccgttctggcggatgcc
gccgaaaatgttgaagaaatcaatcttcagcgagccgaagaggcgcggcgcagggcagag
aatttgctcaaacagggcataccggaagataccgacgaatatcttaacatccaggctgcg
ttgcgccgttctaatctgcgtattgaagcggtcaaaagataccggcgtcatcactaa

DBGET integrated database retrieval system