KEGG   Anaerolinea thermophila: ANT_13850Help
Entry
ANT_13850         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_2 SNAP TPR_11 TPR_16 MIT Exonuc_VII_S TPR_1 DUF2399 DUF3856 TPR_10 Wzy_C_2 TPR_7 TPR_14
Motif
Other DBs
NCBI-ProteinID: BAJ63413
NITE: ANT_13850
UniProt: E8N4P9
Position
complement(1550282..1550827)
Genome map
AA seq 181 aa AA seqDB search
MEKQLTPDQLAEHGQRLYRSGKHLEAAEQFEKASKAFAELGDVLKSAEMANNRSVALLQA
GDAQGALDACAGTEQIFHKAGDTEREGIAIANYAAALEGLNRLEEALEHYQRAAALFKQI
NHSEMRAVVLKAISSLQIRTNRQFEALASMDAALEEQKKLSLRERLLKKIIDLPFKMIGK
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaacttactccagaccaacttgccgagcacggacaacggctttaccgctca
ggaaagcatctcgaagcggcagagcaatttgagaaagcctcaaaagcgtttgccgaactc
ggagacgttctgaaatctgcagaaatggcaaacaaccgtagtgttgccctgttgcaggca
ggcgatgcccagggggcactcgatgcttgtgcaggtaccgagcaaatcttccacaaagcc
ggagatacagaacgggaaggcatcgccattgccaactatgctgcagccctggaaggcttg
aatcggctggaagaagcactggagcattatcaacgtgccgccgcattgttcaagcagata
aaccattcggaaatgcgcgccgtggtgcttaaagccatctcgtctctgcaaattcgaacc
aaccgccagtttgaagcccttgccagcatggatgccgcactcgaagaacagaaaaaactt
tctctaagggaacgattgctgaagaaaatcatcgatcttccattcaagatgatagggaaa
aagtga

DBGET integrated database retrieval system