KEGG   Anaerolinea thermophila: ANT_13940Help
Entry
ANT_13940         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA Sigma54_AID
Motif
Other DBs
NCBI-ProteinID: BAJ63422
NITE: ANT_13940
UniProt: E8N4Q8
Position
complement(1557358..1557777)
Genome map
AA seq 139 aa AA seqDB search
MANISHELRTPLTHLTGYLDLLLSGDLGPLNPQQRAALEVIQRSSERLAQLIEDLILFSV
SEKNQIYLNIRPVNAFELLSSVYQRNSPKAIERQINFHFEPPESTLLVAADQEKVSWVLC
CKDRLGRDTPSGVCCRPVL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaacatttctcacgaactgcgtacacccttaacccacttaaccggttacctggat
ttgcttctcagcggagatttaggcccgttaaatccacagcaacgcgctgccctggaagtt
attcaacgctcctctgaacgattggcccagttaatcgaggatttgattcttttctccgtc
agcgagaaaaaccaaatttacctcaacattcgtcccgtcaatgccttcgaattactgtcc
tcggtttaccagcgaaattccccaaaggcaattgaacgacagataaatttccactttgag
ccaccagaaagcacattactggttgctgccgaccaggaaaaagtttcctgggtgctctgt
tgcaaagataggttaggaagagatacacctagcggtgtatgttgtagaccagtcctttga

DBGET integrated database retrieval system